KEGG   Rhodospirillum rubrum F11: F11_17730Help
Entry
F11_17730         CDS       T02006                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    F11_17730
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     F11_17730
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F11_17730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3985923..3987440
Genome map
AA seq 505 aa AA seqDB search
MNAKARKKMIIRDDLILAIDQGTSGTRALLFDQHGPVHSGGRLALAPTHPRDGWVEIDPE
DIWLDVLTAWRQVLEGSGADHVTAIALATQRDTTIVWDRRTGKPVYNAISWLDRRGAARC
RELVETGYESLVRVRSGLVVDSAFAATKVAWILENVEGARAAAEAGHLAFGTVDSFLLWR
LTGGAVHATDASNASRTMLFNIHSQRWDADLLALFGVPWQMMPEVRDSACVFGHTDRAGF
GRPIPIAAMIGDQSAALIGQGCLTPGMIKAGMGASCVMIANTGPTALASRHGLLTSIAYR
LDGEVTYALEGTVFSAGAAIGWLSESLGVIERPEITELLARGMKGNRGVYMVPAFSGLGA
PYWDPGARGAIFGLSHDTGVPELARAALESVAYQAYDLLEAMIADGLPRPAVLRVEGAMS
ANDWLLSFLANILEVPVERPAIAETAAMGAALLAGVHLGLYGSLDAAGNAWEGNGRFDPA
IDPAYRRQLLDGWRKAVGRVQESAP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaagcgcgcaagaaaatgattatccgcgatgacctgatcctggccatcgac
cagggcacatcgggaacgcgcgccttgttgttcgaccagcacgggccggtccatagcggc
ggccggctggcgctggcgcccacccatccgcgcgacggttgggtcgagatcgatcccgag
gatatctggctcgacgtgctgaccgcttggcgtcaggtcctcgaaggcagcggcgccgat
cacgtcaccgccatcgccctggccacccagcgcgacaccaccatcgtctgggaccggcgt
accggcaagccggtctataacgccatttcctggcttgatcggcggggcgcggcgcgctgc
cgggagttggtggagaccggctatgaaagcttggtgcgggtgcgcagcggtctggtcgtc
gacagcgcctttgccgccaccaaggtggcctggatccttgagaacgtcgagggcgcccgg
gcggcggccgaagccggccatctcgccttcggcaccgtcgacagctttctgctgtggcga
ttgaccggcggcgccgttcacgccaccgacgcgtcgaacgccagccggacgatgctgttc
aacatccatagccagcgctgggacgccgatctgctggcgttgtttggcgttccctggcag
atgatgcccgaggtgcgcgacagcgcctgcgtttttggccatacggaccgcgccggcttc
ggccggccgattccgatcgccgcgatgatcggcgatcaaagcgccgccctgatcggccag
ggctgcctgacgccgggcatgatcaaggccggaatgggggcgagttgcgtgatgatcgcc
aataccggaccgacggcgctggcctcccgccacggcctgctgacctcgatcgcctatcgg
ctcgacggcgaggtcacctatgcgctggaagggacggtcttcagcgccggggcggcgatc
ggctggctgagcgaaagcctgggggtgatcgaacgccccgagatcaccgagcttctggcc
cgcgggatgaaaggcaatcgcggggtgtacatggttccggccttcagcggcctgggcgcc
ccctattgggatccgggggctcggggggccattttcggcctgtcccatgacacgggggtt
cccgaactggcgcgcgccgccctggaaagcgtcgcctatcaggcctacgacctgctcgag
gcgatgatcgccgatggcctgcccaggccagcggtgctgcgggtcgaaggggcgatgagc
gccaatgactggctgctgtcgtttctggccaatatccttgaggtgccggttgaacgaccg
gccatcgccgagacggcggccatgggcgccgccctgctggcgggggtccaccttgggctg
tatggctcgctcgacgcggccggcaacgcctgggagggcaatgggcgttttgacccggcg
atcgatccggcctatcgccgtcaactgcttgacggctggcgcaaagccgtcggacgggtt
caggagtcggcgccatga

DBGET integrated database retrieval system