KEGG   Rhodospirillum rubrum F11: F11_17730Help
Entry
F11_17730         CDS       T02006                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rrf00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3985923..3987440
Genome map
AA seq 505 aa AA seqDB search
MNAKARKKMIIRDDLILAIDQGTSGTRALLFDQHGPVHSGGRLALAPTHPRDGWVEIDPE
DIWLDVLTAWRQVLEGSGADHVTAIALATQRDTTIVWDRRTGKPVYNAISWLDRRGAARC
RELVETGYESLVRVRSGLVVDSAFAATKVAWILENVEGARAAAEAGHLAFGTVDSFLLWR
LTGGAVHATDASNASRTMLFNIHSQRWDADLLALFGVPWQMMPEVRDSACVFGHTDRAGF
GRPIPIAAMIGDQSAALIGQGCLTPGMIKAGMGASCVMIANTGPTALASRHGLLTSIAYR
LDGEVTYALEGTVFSAGAAIGWLSESLGVIERPEITELLARGMKGNRGVYMVPAFSGLGA
PYWDPGARGAIFGLSHDTGVPELARAALESVAYQAYDLLEAMIADGLPRPAVLRVEGAMS
ANDWLLSFLANILEVPVERPAIAETAAMGAALLAGVHLGLYGSLDAAGNAWEGNGRFDPA
IDPAYRRQLLDGWRKAVGRVQESAP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgaaagcgcgcaagaaaatgattatccgcgatgacctgatcctggccatcgac
cagggcacatcgggaacgcgcgccttgttgttcgaccagcacgggccggtccatagcggc
ggccggctggcgctggcgcccacccatccgcgcgacggttgggtcgagatcgatcccgag
gatatctggctcgacgtgctgaccgcttggcgtcaggtcctcgaaggcagcggcgccgat
cacgtcaccgccatcgccctggccacccagcgcgacaccaccatcgtctgggaccggcgt
accggcaagccggtctataacgccatttcctggcttgatcggcggggcgcggcgcgctgc
cgggagttggtggagaccggctatgaaagcttggtgcgggtgcgcagcggtctggtcgtc
gacagcgcctttgccgccaccaaggtggcctggatccttgagaacgtcgagggcgcccgg
gcggcggccgaagccggccatctcgccttcggcaccgtcgacagctttctgctgtggcga
ttgaccggcggcgccgttcacgccaccgacgcgtcgaacgccagccggacgatgctgttc
aacatccatagccagcgctgggacgccgatctgctggcgttgtttggcgttccctggcag
atgatgcccgaggtgcgcgacagcgcctgcgtttttggccatacggaccgcgccggcttc
ggccggccgattccgatcgccgcgatgatcggcgatcaaagcgccgccctgatcggccag
ggctgcctgacgccgggcatgatcaaggccggaatgggggcgagttgcgtgatgatcgcc
aataccggaccgacggcgctggcctcccgccacggcctgctgacctcgatcgcctatcgg
ctcgacggcgaggtcacctatgcgctggaagggacggtcttcagcgccggggcggcgatc
ggctggctgagcgaaagcctgggggtgatcgaacgccccgagatcaccgagcttctggcc
cgcgggatgaaaggcaatcgcggggtgtacatggttccggccttcagcggcctgggcgcc
ccctattgggatccgggggctcggggggccattttcggcctgtcccatgacacgggggtt
cccgaactggcgcgcgccgccctggaaagcgtcgcctatcaggcctacgacctgctcgag
gcgatgatcgccgatggcctgcccaggccagcggtgctgcgggtcgaaggggcgatgagc
gccaatgactggctgctgtcgtttctggccaatatccttgaggtgccggttgaacgaccg
gccatcgccgagacggcggccatgggcgccgccctgctggcgggggtccaccttgggctg
tatggctcgctcgacgcggccggcaacgcctgggagggcaatgggcgttttgacccggcg
atcgatccggcctatcgccgtcaactgcttgacggctggcgcaaagccgtcggacgggtt
caggagtcggcgccatga

DBGET integrated database retrieval system