KEGG   Rhodospirillum rubrum F11: F11_18300Help
Entry
F11_18300         CDS       T02006                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_18300
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_18300
   00620 Pyruvate metabolism
    F11_18300
   00640 Propanoate metabolism
    F11_18300
  Energy metabolism
   00680 Methane metabolism
    F11_18300
Enzymes [BR:rrf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     F11_18300
Lipid biosynthesis proteins [BR:rrf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   F11_18300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4118508..4120448
Genome map
AA seq 646 aa AA seqDB search
MSESVLVPVPEAIAKAALVNEAQYLDLYKSSIADPDAFWAEHGKRIDWIKPFTAVKDVSF
DPHDVHIRWFHDGTLNVSVNCLDRHLETRGDQTAILWEGDDPKDDARITYRDLYERVCKL
ANAFRELGVKKGDRVCIYLPMIPEAAVAMLACARIGAVHSIVFGGFSPDSLANRIQDSEC
TLVITSDEGLRGGRKVALKKNVDTALEHCPSVKTVVVVKRTGGAIDTVEGRDVWYHEITA
NQPAECQPEEMNAEDPLFILYTSGSTGKPKGVLHTSGGYLVYVSMTHEYVFDYKDGEVYW
CTADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDVSRFWQVVEKHKVNIFYTAPTAIR
ALMREGEEPVKKHDRSSLRILGSVGEPINPEAWTWYHRVVGEDRCPIVDTWWQTETGGIL
ITPLPGATKLKPGSATLPFFGVEPVLVDAEGNELSGATEGNLCIARSWPGQMRTVYGDHE
RFVQTYFSTYKGYYFTGDGCRRDEDGYYWITGRVDDVINVSGHRMGTAEIESALVAHPKV
AEAAVVGFPHDIKGQGIYAYVTLVAGEKETDALRKELVAWVRKDIGPIASPDIIQWAPGL
PKTRSGKIMRRILRKIAENEFGALGDTSTLADPTVVEDLIANRPQA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagtccgttctggttccggtgcccgaagccatcgccaaagccgccttggtcaac
gaggcgcaataccttgatctttacaagtcctccatcgccgaccccgacgccttttgggcc
gagcatggcaagcgcatcgactggatcaaaccctttaccgcggtgaaggatgtttccttt
gatccccacgacgtgcatatccgctggttccacgacggcacgctcaacgtgtcggtcaac
tgcctggaccgtcacctggaaacccggggcgaccagaccgccatcctgtgggagggcgac
gaccccaaggacgacgcccgcatcacctaccgcgatctttacgagcgggtgtgcaagctg
gccaacgccttccgcgagttgggcgtcaaaaagggcgaccgcgtctgcatttatctgccg
atgatccccgaggcggcggtggcgatgctggcctgcgcccgcatcggcgccgttcattcc
atcgtgttcggcggtttctcgcccgatagcctggccaatcgcatccaggattccgaatgc
accctggtcatcacctccgacgagggtctgcgcggcggccgcaaggtggcgctgaaaaag
aacgtcgacaccgccttggagcattgcccgagcgtcaagacggtggtggtggtcaagcgc
accggcggcgccattgacaccgtcgaaggccgcgatgtctggtaccacgagatcaccgcc
aaccagcccgccgaatgccagcccgaggaaatgaacgccgaggatccgctgttcatcctg
tacacctcgggctcgaccggcaagcccaagggcgtgctgcatacctcaggcggctatctg
gtctatgtgtcgatgacccatgaatacgtcttcgactacaaggacggcgaggtttactgg
tgcacggccgatgtcggctgggtgaccggccacagctatatcgtttacgggccgctggcc
aatggcgccatcagcctgatgttcgaaggcgtgcccaattatcccgacgtgtcgcgtttc
tggcaggtggtggaaaagcacaaggtcaacatcttctacaccgcccccaccgccatccgc
gccctgatgcgcgagggcgaggagccggtgaagaagcatgaccgctcgtcgctgcgcatc
cttggctcggtcggcgaaccgatcaatcccgaggcctggacctggtaccaccgggtggtg
ggcgaggatcggtgcccgatcgtcgatacttggtggcagaccgaaaccggcggcatcctg
atcacgccgctgcccggggcgaccaagctcaagcccggatcggccaccttgccgttcttc
ggggtcgagccggtgctggtcgatgccgagggcaacgaactgagcggggcgaccgagggc
aatctgtgcatcgcccgctcgtggccggggcagatgcgcacggtctatggcgatcacgag
cgcttcgtgcagacctatttctccacctacaagggctattacttcaccggcgacggctgc
cgccgcgacgaggacggctattactggatcaccggccgcgtcgatgacgtcatcaacgtg
tcgggccaccgcatgggaacggccgagatcgaatcggccctggtcgcccatcccaaggtg
gccgaagccgccgtcgtcggcttcccccacgacatcaagggccaaggcatctacgcctat
gtcaccctggtggccggcgagaaggaaaccgacgccctgcgcaaggaactggtggcctgg
gtccgcaaggacatcggaccgatcgccagccccgatatcatccagtgggcgcccggcctg
cccaagacgcgctcgggcaagatcatgcgccgcatcctgcgcaagatcgccgagaacgaa
ttcggcgcccttggcgatacctcgaccctggccgatccgacggtggtggaagacctgatc
gccaatcgtccccaggcgtaa

DBGET integrated database retrieval system