KEGG   Rickettsia rickettsii Hauke: RPM_00215Help
Entry
RPM_00215         CDS       T01723                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rrh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rrh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(36754..37248)
Genome map
AA seq 164 aa AA seqDB search
MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIVMGRKTFDSRPTKILK
NCICIVFSRNTPLQSYNNIFFIKSLDDFWQVIKPFTDKKIFMVGGTEIATLFLEQNLIDE
FLLTKINKNYDGDTFLPLNLLAEWHSVIIDKTNNYQIYKFTKRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaaaaatcatcggtataatggcatgtgacccacaaggggtgataggtaat
aaaggtcagatgccttggtcttatactaaggagtttgaatatttttatcagacggtaaaa
aataatattatagtcatgggacgaaaaacctttgactctagacccacaaagattttaaaa
aattgtatttgtattgttttttcaagaaatacaccattacaatcttataataatatattt
tttattaaatccttagatgatttttggcaggtaataaaaccttttactgataaaaaaatt
tttatggttggagggacagaaatagcaactcttttcctagaacaaaatcttattgatgaa
tttttacttacaaaaataaataaaaattatgatggagatacttttttgcctcttaatctt
ttagcagaatggcattctgtaataatagataaaacaaacaattatcagatttataaattt
actaagaggaggtaa

DBGET integrated database retrieval system