KEGG   Rickettsia rickettsii Hauke: RPM_01895Help
Entry
RPM_01895         CDS       T01723                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
rrh01100  Metabolic pathways
rrh01120  Microbial metabolism in diverse environments
rrh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPM_01895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 ATP-synt_B SDF
Motif
Other DBs
NCBI-ProteinID: AFB29977
Position
complement(342122..342649)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSANQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagcaaatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgcgttcttacataaa
ccaagtaactatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system