KEGG   Rickettsia rickettsii Hauke: RPM_01895Help
Entry
RPM_01895         CDS       T01723                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rrh00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rrh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342122..342649)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSANQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagcaaatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgcgttcttacataaa
ccaagtaactatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system