KEGG   Rickettsia rickettsii Hauke: RPM_03340Help
Entry
RPM_03340         CDS       T01723                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
rrh00020  Citrate cycle (TCA cycle)
rrh00640  Propanoate metabolism
rrh01100  Metabolic pathways
rrh01110  Biosynthesis of secondary metabolites
rrh01120  Microbial metabolism in diverse environments
rrh01130  Biosynthesis of antibiotics
rrh01200  Carbon metabolism
Module
rrh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPM_03340 (sucC)
   00640 Propanoate metabolism
    RPM_03340 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RPM_03340 (sucC)
Enzymes [BR:rrh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RPM_03340 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFB30242
Position
complement(590259..591419)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCEILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLLRHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKAVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgagattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attacttttatagcttctacggaaggaggagttgatattgaagaggtagcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagctaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttattgcggcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcgaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcacctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagcagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgccgctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggtaaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system