KEGG   Rickettsia rickettsii Hauke: RPM_06555Help
Entry
RPM_06555         CDS       T01723                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rrh  Rickettsia rickettsii Hauke
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPM_06555 (gmk)
Enzymes [BR:rrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RPM_06555 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093681..1094370)
Genome map
AA seq 229 aa AA seqDB search
MTTKNKRVLQKCAYREEFKGDMERSTAVTSKLPLEVELSRNSKGLIIILSSPSGTGKSSL
AKALLKIDNNLRLSISATTRKPRLGEVEGINYYFKTGLEFEELVKQNKFLEYAKIYDNYY
GTPKEYVEMLLNQGLDVLFDIDWQGARSIKENATNVVAIFVLPPNIEVLEQRLRNRATDN
EEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIVAARDKAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaataaaagagttcttcagaaatgcgcttatagagaggaatttaaaggc
gacatggaacgtagcaccgcagtgacgtctaaattacctctagaagtagaactttcgagg
aactctaaaggactgattataattttatcttccccttcaggtacaggtaagtcgagttta
gctaaagcattattgaaaatagataataatttgcgtttatctatttcggcaactacaaga
aaaccacgtttaggagaagtagagggcataaactattactttaagaccggtctagagttt
gaagaattagttaagcagaataaattccttgaatatgctaaaatatacgataattattac
ggtacgcctaaagaatatgtcgaaatgttattaaatcaaggcttggatgttttgtttgat
attgattggcaaggagcacggagtattaaggaaaatgctactaatgttgttgctatattt
gtattgcctcctaatattgaagtattggaacaacgcttaagaaatagagcgaccgataat
gaagaagcaataaaattacgtatgcagtcggcacaaaacgaaatatcacatgctaatgag
tatgattatgtagttactaacgatgactttgaccggacgcttaaaaaaatacatgcgatt
atagttgcagcacgagacaaagcgttttga

DBGET integrated database retrieval system