KEGG   Rickettsia rickettsii Sheila Smith: A1G_00975Help
Entry
A1G_00975         CDS       T00604                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
rri00020  Citrate cycle (TCA cycle)
rri00190  Oxidative phosphorylation
rri00650  Butanoate metabolism
rri01100  Metabolic pathways
rri01110  Biosynthesis of secondary metabolites
rri01120  Microbial metabolism in diverse environments
rri01130  Biosynthesis of antibiotics
rri01200  Carbon metabolism
Module
rri_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rri_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rri_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rri00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1G_00975
   00650 Butanoate metabolism
    A1G_00975
  Energy metabolism
   00190 Oxidative phosphorylation
    A1G_00975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt tRNA_anti_2 CybS PAP2 Fumarate_red_D Mem_trans Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABV75777
UniProt: A0A0H3AWZ1
Position
170459..170836
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system