KEGG   Rickettsia rickettsii Sheila Smith: A1G_03430Help
Entry
A1G_03430         CDS       T00604                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rri03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598653..599258
Genome map
AA seq 201 aa AA seqDB search
MNETNYNDIDQLIYLFSKLPGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCE
ICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQN
PSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaattataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtattagatcggcaaggcgtatagcgctttacctattgcaagataaagacgta
aggttaaaaagcctgattaataatcttgtagagatagataagaaaatagtaaaatgcgag
atttgcggtaatatggatacggaaaatatttgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgtcgaaactgtggctgaattatgggcaatggagcgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtagacaaaac
cctagcatacttcggttacctgaactacttacaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system