KEGG   Rickettsia rickettsii Sheila Smith: A1G_04875Help
Entry
A1G_04875         CDS       T00604                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
rri00520  Amino sugar and nucleotide sugar metabolism
rri00550  Peptidoglycan biosynthesis
rri01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rri00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A1G_04875
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A1G_04875
Enzymes [BR:rri01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     A1G_04875
Peptidoglycan biosynthesis and degradation proteins [BR:rri01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   A1G_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ABV76475
UniProt: A8GSV0
Position
complement(821920..823179)
Genome map
AA seq 419 aa AA seqDB search
MHKLIIHGGTPLKGSINISGAKNAVLPIMAASILTDKLHITNVPKLTDVSTMKDLLRSHG
ADIEIIKHQDEFELIIDTKNINNFTADYEIVRKMRASIWVLGPLLTKYGKAKVSLPGGCA
IGARQVDLHIAVLKAMGAEIEIEDGYINASSKGRLKGTHFVFDKVSVGATINAILVAVLA
EGETVLFNCGREPEIVDLCNCLITMGADIAGIGTSEITIKGKDSLNKASYKVLSDRIEAG
TYMFAAAITKGDVKICGIDYHIVENIALKLIETGIKVVPINNGVQVTYEGKLNSVDLETN
PYPGFATDLQAQFMSLMTLSSGVSMITENIFENRFMHVPELCRMGADIVVRGNKAVVRGV
EMLKGAEVMASDLRASVSLILAGLSTNSKTVLHRIYHLDRGFQDLEKKLSNCGADIKRV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaattgattattcacggtggtacacctctgaaaggtagtattaatattagcggt
gctaaaaatgccgtgctacctattatggcagcgtctattcttaccgataaactgcatatt
actaatgttccaaagttaacggatgttagtactatgaaagatttgctccgaagtcacggg
gcagatattgaaataataaaacatcaagatgaatttgagcttataattgataccaaaaat
ataaataactttactgcagattatgaaatagtccgtaaaatgagagcatcgatttgggtg
cttggtcctttgcttaccaaatacggtaaagcaaaagtatcgcttccgggtggttgtgct
attggagcaaggcaagtagatttgcatattgctgtattaaaagctatgggagctgagatt
gaaatagaagacggttatattaacgcttcaagtaaaggacgcttaaaaggtactcatttt
gtttttgataaagtttccgtaggtgctacgattaatgcaatacttgtagctgttttagca
gagggggaaactgtgctttttaattgtggtcgagagccggaaatagttgatttatgtaat
tgtcttatcacaatgggagccgatattgcaggtatcggcactagcgaaataacaattaaa
ggcaaggattctttaaataaagcgagctataaagtactttctgatcgtattgaagccggt
acttatatgtttgcggcagctattactaaaggtgatgtaaaaatttgtgggattgattac
catattgtagaaaatatagctttaaaacttatcgaaacgggtataaaagtcgtgccgatc
aataacggagttcaagtaacttatgaagggaagttaaattcagtggatttagaaactaat
ccctatcctggctttgctactgatttgcaagcacaatttatgagccttatgacgcttagt
agcggtgtttcaatgatcaccgagaatatttttgaaaatcgtttcatgcatgttcctgaa
ttatgtagaatgggagcagatatagtagtacgaggtaataaggcggttgttcgaggtgta
gaaatgttaaaaggcgcagaagttatggcaagtgatcttagagcttcggtatcgctaata
ctcgctggtcttagtactaatagcaaaaccgtattacaccgaatatatcatttagatcgt
ggcttccaagatttagaaaaaaaattaagtaattgtggtgcagatataaaaagggtataa

DBGET integrated database retrieval system