KEGG   Rickettsia rickettsii Sheila Smith: A1G_07390Help
Entry
A1G_07390         CDS       T00604                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rri00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A1G_07390
   00240 Pyrimidine metabolism
    A1G_07390
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    A1G_07390
   03430 Mismatch repair
    A1G_07390
   03440 Homologous recombination
    A1G_07390
Enzymes [BR:rri01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A1G_07390
DNA replication proteins [BR:rri03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     A1G_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238556..1239020)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctatcactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataactgatttacccgaa
gatttaaaagaattaacagttaaaataaataaatttaccgaacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggaataaggtagtctaa

DBGET integrated database retrieval system