KEGG   Rickettsia rickettsii Sheila Smith: A1G_07400Help
Entry
A1G_07400         CDS       T00604                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rri  Rickettsia rickettsii Sheila Smith
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rri01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rri00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1239220..1240365)
Genome map
AA seq 381 aa AA seqDB search
MYINYLKDLISFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSN
EPNICFVGHVDVVLEGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIK
NNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIG
RRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNI
EVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAES
FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY
TKISDLQKLYDVYYNFLMEIL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgattagttttaagtctgtaactcctaagagcgat
ggggctattgagtatattaatgatttgcttaaacagcacggctttaagaccgaaataaaa
atattcggtgattctaaaagtgagcaagtcactaatctttatgctgttttcggtagcaat
gagcctaatatttgctttgttggtcatgtagatgtagtgttggaaggcaatcatgagctt
tggcataatgcgagtccatttaaagttagccagcaagatggtaagatatatggcagaggt
gcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttataaaa
aataataccgattttaaaggttccattagtttcttacttactagtgatgaagagggaaaa
gcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagataaat
tttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagattggc
agaagaggaagtgttaactttaaattaaatatagaaggtttaagcgggcatgtagcttat
cctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaacaaat
ataaaacttgatgaaggtactgaattttttcaacgttcaaatcttgaagtaacgaatatc
gaggtcagtaataatacttcaaacgtaattccggccagtacggaagcatctttcaatata
cgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattattaaa
cagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaaagt
tttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacgctt
aaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaaaat
tattgtccgttagtagagtttggtttattatccgaaacggcacataagataaacgaatac
acaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaaata
ctttga

DBGET integrated database retrieval system