KEGG   Rickettsia rickettsii Iowa: RrIowa_0280Help
Entry
RrIowa_0280       CDS       T00643                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00020  Citrate cycle (TCA cycle)
rrj00310  Lysine degradation
rrj01100  Metabolic pathways
rrj01110  Biosynthesis of secondary metabolites
rrj01120  Microbial metabolism in diverse environments
rrj01130  Biosynthesis of antibiotics
rrj01200  Carbon metabolism
Module
rrj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RrIowa_0280
  Amino acid metabolism
   00310 Lysine degradation
    RrIowa_0280
Enzymes [BR:rrj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RrIowa_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ABY72189
UniProt: B0BWG3
Position
complement(236498..237685)
Genome map
AA seq 395 aa AA seqDB search
MRVNIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVHAPCNGTIGKIS
KTDGANVAVGEEIGEINEGASVNTAGTNNESAKAQPVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaacattatagtaccgtcgcttggggagtccataacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttcatgctccttgcaatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgtaaatactgccggtactaataatgaatctgctaaagctcaaccagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtt
accgaaaataagcttgaccccaataatataaaaggaacaggtagagatggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacactgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggatttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatgatgtatata
gctttatcttacgatcatcgtataattgatgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system