KEGG   Rickettsia rickettsii Iowa: RrIowa_0407Help
Entry
RrIowa_0407       CDS       T00643                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj01100  Metabolic pathways
rrj01120  Microbial metabolism in diverse environments
rrj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RrIowa_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 ATP-synt_B SDF
Motif
Other DBs
NCBI-ProteinID: ABY72302
UniProt: B0BWS6
Position
complement(342169..342696)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSANQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagcaaatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgcgttcttacataaa
ccaagtaactatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system