KEGG   Rickettsia rickettsii Iowa: RrIowa_1399Help
Entry
RrIowa_1399       CDS       T00643                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RrIowa_1399
Enzymes [BR:rrj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RrIowa_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093039..1093728)
Genome map
AA seq 229 aa AA seqDB search
MTTKNKRVLQKCAYREEFKGDMERSTAVTSKLPLEVELSRNSKGLIIILSSPSGTGKSSL
AKALLKIDNNLRLSISATTRKPRLGEVEGINYYFKTGLEFEELVKQNKFLEYAKIYDNYY
GTPKEYVEMLLNQGLDVLFDIDWQGARSIKENATNVVAIFVLPPNIEVLEQRLRNRATDN
EEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIVAARDKAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaataaaagagttcttcagaaatgcgcttatagagaggaatttaaaggc
gacatggaacgtagcaccgcagtgacgtctaaattacctctagaagtagaactttcgagg
aactctaaaggactgattataattttatcttccccttcaggtacaggtaagtcgagttta
gctaaagcattattgaaaatagataataatttgcgtttatctatttcggcaactacaaga
aaaccacgtttaggagaagtagagggcataaactattactttaagaccggtctagagttt
gaagaattagttaagcagaataaattccttgaatatgctaaaatatacgataattattac
ggtacgcctaaagaatatgtcgaaatgttattaaatcaaggcttggatgttttgtttgat
attgattggcaaggagcacggagtattaaggaaaatgctactaatgttgttgctatattt
gtattgcctcctaatattgaagtattggaacaacgcttaagaaatagagcgaccgataat
gaagaagcaataaaattacgtatgcagtcggcacaaaacgaaatatcacatgctaatgag
tatgattatgtagttactaacgatgactttgaccggacgcttaaaaaaatacatgcgatt
atagttgcagcacgagacaaagcgttttga

DBGET integrated database retrieval system