KEGG   Rickettsia rickettsii Iowa: RrIowa_1577Help
Entry
RrIowa_1577       CDS       T00643                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00230  Purine metabolism
rrj00240  Pyrimidine metabolism
rrj01100  Metabolic pathways
rrj03030  DNA replication
rrj03430  Mismatch repair
rrj03440  Homologous recombination
Module
rrj_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RrIowa_1577
   00240 Pyrimidine metabolism
    RrIowa_1577
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RrIowa_1577
   03430 Mismatch repair
    RrIowa_1577
   03440 Homologous recombination
    RrIowa_1577
Enzymes [BR:rrj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RrIowa_1577
DNA replication proteins [BR:rrj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RrIowa_1577
DNA repair and recombination proteins [BR:rrj03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RrIowa_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABY73294
UniProt: B0BVN4
Position
complement(1249121..1249585)
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYHSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDELQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTEQENKIDCFTQNPRGAWNKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctatcactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgatgagttacaa
aatcctaataatgctagtgtgcttgttattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataactgatttacccgaa
gatttaaaagaattaacagttaaaataaataaatttaccgaacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggaataaggtagtctaa

DBGET integrated database retrieval system