KEGG   Rickettsia rickettsii Iowa: RrIowa_1579Help
Entry
RrIowa_1579       CDS       T00643                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rrj  Rickettsia rickettsii Iowa
Pathway
rrj00300  Lysine biosynthesis
rrj01100  Metabolic pathways
rrj01120  Microbial metabolism in diverse environments
rrj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rrj00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RrIowa_1579
Enzymes [BR:rrj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RrIowa_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABY73295
UniProt: B0BVN5
Position
complement(1249785..1250933)
Genome map
AA seq 382 aa AA seqDB search
MMYINYLKDLISFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGS
NEPNICFVGHVDVVLEGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFI
KNNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKI
GRRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTN
IEVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAE
SFIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINE
YTKISDLQKLYDVYYNFLMEIL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtacattaactacttaaaagatttgattagttttaagtctgtaactcctaagagc
gatggggctattgagtatattaatgatttgcttaaacagcacggctttaagaccgaaata
aaaatattcggtgattctaaaagtgagcaagtcactaatctttatgctgttttcggtagc
aatgagcctaatatttgctttgttggtcatgtagatgtagtgttggaaggcaatcatgag
ctttggcataatgcgagtccatttaaagttagccagcaagatggtaagatatatggcaga
ggtgcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttata
aaaaataataccgattttaaaggttccattagtttcttacttactagtgatgaagaggga
aaagcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagata
aattttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagatt
ggcagaagaggaagtgttaactttaaattaaatatagaaggtttaagcgggcatgtagct
tatcctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaaca
aatataaaacttgatgaaggtactgaattttttcaacgttcaaatcttgaagtaacgaat
atcgaggtcagtaataatacttcaaacgtaattccggccagtacggaagcatctttcaat
atacgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattatt
aaacagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaa
agttttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacg
cttaaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaa
aattattgtccgttagtagagtttggtttattatccgaaacggcacataagataaacgaa
tacacaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaa
atactttga

DBGET integrated database retrieval system