KEGG   Rickettsia rickettsii Hino: RPJ_00225Help
Entry
RPJ_00225         CDS       T01738                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RPJ_00225
Enzymes [BR:rrn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RPJ_00225
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RPJ_00225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37668..38624)
Genome map
AA seq 318 aa AA seqDB search
MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQSIIFETQAILQPDADKAWDKSYLNMV
VQGKSTLTPSKLLIELKKIEKQLGRASSYDKWSPRVIDLDILLWNNCHIDLPDLKIPHPE
LLNKPFLIHLLIHLIAGLSLECRYSCPINNFYNNKTFAEIAHLIENQGVIGSLVLNPQFV
GILNITPDSFSDGGLSFHNEGATIIELGSQSTRPSALIINEDEEYARLNNVLEELKEVIK
EKEVIVSIDSFTPEVIKRVLKKYPISYINLVKNNLDDYTLRLIADYNCKIITMHSLTVPP
QKQKCLDFDKSPLASLNI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggtaataaacttttaaatattaaaaaagct
ctaaattcactaaaaagttgtaattttatatcgcttaagcaatctattatttttgaaaca
caagctattctacaacctgatgcagataaagcttgggataaatcatatttaaatatggtg
gtgcagggcaaaagtactttaacgcctagtaaacttctaattgagcttaaaaagattgaa
aaacaactaggtcgagcaagctcttacgataaatggtctccaagagttattgatttagat
atcctactttggaataattgccatatagatttacctgatttaaagataccgcatcctgaa
ttattaaacaaaccgtttcttattcatcttcttattcatctaattgcaggtttaagcttg
gaatgtcgttattcatgtccgatcaataatttttacaacaataaaacctttgcagaaata
gcacatttaattgaaaatcaaggagttataggctctcttgttttaaatcctcaatttgtc
ggtattttaaacattactcctgattctttttctgatggaggattgagttttcataatgaa
ggggctacaataattgagcttggatcacaatcaacacgtccttctgctttaattattaat
gaagatgaagaatatgcaaggctcaataatgttcttgaagagcttaaggaagttataaag
gaaaaagaagttatagtcagtattgatagttttactcctgaagtaattaaacgtgtttta
aaaaaataccctatttcctatatcaacttggttaaaaataatctagatgattatacatta
cgattaattgccgattataattgtaaaattattactatgcattcattaactgttccaccg
caaaaacaaaaatgtcttgatttcgataaatctccgcttgctagcttaaatatatag

DBGET integrated database retrieval system