KEGG   Rickettsia rickettsii Hino: RPJ_00225Help
Entry
RPJ_00225         CDS       T01738                                 

Definition
folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rrn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37668..38624)
Genome map
AA seq 318 aa AA seqDB search
MIYISIGSNLGNKLLNIKKALNSLKSCNFISLKQSIIFETQAILQPDADKAWDKSYLNMV
VQGKSTLTPSKLLIELKKIEKQLGRASSYDKWSPRVIDLDILLWNNCHIDLPDLKIPHPE
LLNKPFLIHLLIHLIAGLSLECRYSCPINNFYNNKTFAEIAHLIENQGVIGSLVLNPQFV
GILNITPDSFSDGGLSFHNEGATIIELGSQSTRPSALIINEDEEYARLNNVLEELKEVIK
EKEVIVSIDSFTPEVIKRVLKKYPISYINLVKNNLDDYTLRLIADYNCKIITMHSLTVPP
QKQKCLDFDKSPLASLNI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatttctataggcagtaatttaggtaataaacttttaaatattaaaaaagct
ctaaattcactaaaaagttgtaattttatatcgcttaagcaatctattatttttgaaaca
caagctattctacaacctgatgcagataaagcttgggataaatcatatttaaatatggtg
gtgcagggcaaaagtactttaacgcctagtaaacttctaattgagcttaaaaagattgaa
aaacaactaggtcgagcaagctcttacgataaatggtctccaagagttattgatttagat
atcctactttggaataattgccatatagatttacctgatttaaagataccgcatcctgaa
ttattaaacaaaccgtttcttattcatcttcttattcatctaattgcaggtttaagcttg
gaatgtcgttattcatgtccgatcaataatttttacaacaataaaacctttgcagaaata
gcacatttaattgaaaatcaaggagttataggctctcttgttttaaatcctcaatttgtc
ggtattttaaacattactcctgattctttttctgatggaggattgagttttcataatgaa
ggggctacaataattgagcttggatcacaatcaacacgtccttctgctttaattattaat
gaagatgaagaatatgcaaggctcaataatgttcttgaagagcttaaggaagttataaag
gaaaaagaagttatagtcagtattgatagttttactcctgaagtaattaaacgtgtttta
aaaaaataccctatttcctatatcaacttggttaaaaataatctagatgattatacatta
cgattaattgccgattataattgtaaaattattactatgcattcattaactgttccaccg
caaaaacaaaaatgtcttgatttcgataaatctccgcttgctagcttaaatatatag

DBGET integrated database retrieval system