KEGG   Rickettsia rickettsii Hino: RPJ_00385Help
Entry
RPJ_00385         CDS       T01738                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
rrn01040  Biosynthesis of unsaturated fatty acids
rrn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rrn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RPJ_00385
Enzymes [BR:rrn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RPJ_00385
Lipid biosynthesis proteins [BR:rrn01004]
 Desaturase
  First
   RPJ_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Fusion_gly PRESAN Dna2
Motif
Other DBs
NCBI-ProteinID: AFB27033
Position
complement(57289..58482)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGAKWYHLDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSAAKQI
TEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcccgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtttgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggaccaagaccaagatccgcatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatataggatggatgctagtcggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggtggt
actatgcaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcatttggacgtt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactatcaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagtgctgcaaagcaaata
acagaaaaatcttcggaaaaactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaattag

DBGET integrated database retrieval system