KEGG   Rickettsia rickettsii Hino: RPJ_00955Help
Entry
RPJ_00955         CDS       T01738                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rrn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPJ_00955
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPJ_00955
   00650 Butanoate metabolism
    RPJ_00955
  Energy metabolism
   00190 Oxidative phosphorylation
    RPJ_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170639..171016
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWA
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcagagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaataaaaataatgatataaatattattatgtgggca
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system