KEGG   Rickettsia rickettsii Hino: RPJ_01275Help
Entry
RPJ_01275         CDS       T01738                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPJ_01275
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPJ_01275
  Amino acid metabolism
   00310 Lysine degradation
    RPJ_01275
Enzymes [BR:rrn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPJ_01275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(236585..237772)
Genome map
AA seq 395 aa AA seqDB search
MRVNIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVHAPCNGTIGKIS
KTDGANVAVGEEIGEINEGASVNTAGTNNESAKAQPVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaacattatagtaccgtcgcttggggagtccataacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttcatgctccttgcaatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgtaaatactgccggtactaataatgaatctgctaaagctcaaccagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtt
accgaaaataagcttgaccccaataatataaaaggaacaggtagagatggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacactgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggatttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatgatgtatata
gctttatcttacgatcatcgtataattgatgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system