KEGG   Rickettsia rickettsii Hino: RPJ_01895Help
Entry
RPJ_01895         CDS       T01738                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rrn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RPJ_01895
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RPJ_01895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(342255..342782)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSANQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSNYAPGTKMSFAGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagcaaatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgcgttcttacataaa
ccaagtaactatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system