KEGG   Rickettsia rickettsii Hino: RPJ_03400Help
Entry
RPJ_03400         CDS       T01738                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rrn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
598764..599369
Genome map
AA seq 201 aa AA seqDB search
MNETNYNDIDQLIYLFSKLPGLGIRSARRIALYLLQDKDVRLKSLINNLVEIDKKIVKCE
ICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQN
PSILRLPELLTRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaattataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtattagatcggcaaggcgtatagcgctttacctattgcaagataaagacgta
aggttaaaaagcctgattaataatcttgtagagatagataagaaaatagtaaaatgcgag
atttgcggtaatatggatacggaaaatatttgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgtcgaaactgtggctgaattatgggcaatggagcgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtagacaaaac
cctagcatacttcggttacctgaactacttacaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system