KEGG   Rickettsia rickettsii Hino: RPJ_05930Help
Entry
RPJ_05930         CDS       T01738                                 

Gene name
clpX
Definition
ATP-dependent protease ATP-binding subunit ClpX
Orthology
K03544  
ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
rrn  Rickettsia rickettsii Hino
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(996938..998215)
Genome map
AA seq 425 aa AA seqDB search
MVVEADKKALICSFCSKKQHEVKKLIAGPAVFICDECIDLCTDIMKEENKVALKQITSSI
PTPQKICGILNDYVVGQDQAKKILAVAVYNHYKRLEYIQSGNNDVELNKSNILLIGPTGS
GKTVLAQTLAKILDVPFTMADATSLTEAGYVGEDVENILLRLLIASEFNIAKAQKGIIYI
DEVDKIARKSENPSITRDVSGEGVQQALLKIMEGTVASVPPQGGRKHPQQDFVQLDTSNI
LFICGGAFMGIDSIITSRTNHSSIGFAANVNIDKEKNNSEILKSLEIEDLTKFGLIPEFI
GRLPIVTTLDELDKEALITILTKPKNAIVKQYQKQFELDDAELVIDDSALETIAEKALAK
KTGARGLRSILEHLLLDSMYKVAELKKQRVTITKEVVNGLVEPIMTSLISTKSNKKQPII
ADIPA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagaagctgataaaaaagcattgatttgttcgttttgtagtaaaaaacaacat
gaagtaaaaaaactgatcgcaggtcctgcagtatttatttgtgatgaatgtatagattta
tgtacagatattatgaaagaagaaaataaagttgctttaaagcaaattacttcttcaatt
ccaacgccgcaaaaaatatgtggcattctaaatgattatgtagttgggcaagatcaagcg
aaaaagattttagcagtagcggtttataaccattataagaggcttgaatatatacaatcc
ggcaataatgacgttgagcttaataagtcgaatatcttactgatcggtcctaccggttca
ggaaaaactgtacttgctcaaacgcttgctaaaattttagacgtaccttttactatggcg
gatgctacttccttaacggaagccgggtatgtcggtgaagatgttgagaatatattacta
cgtttattgatagcatctgagtttaatatagcaaaagcacaaaaaggtataatttatatt
gacgaggttgataaaattgcccgtaaatcggagaatccttctattacacgggatgtatcg
ggtgaaggagtacagcaggcattacttaaaattatggaaggaacagttgcttccgtgcct
cctcaaggcggtaggaaacacccacaacaagatttcgtacagttagatacttcaaatatc
ttatttatttgtggtggtgcttttatggggattgatagcattataacctcaagaactaat
catagttctataggctttgcagctaacgtaaatatagataaagagaaaaataatagtgag
attcttaaatccctagagattgaggatttaactaaattcggtttaattcctgaatttatc
ggtagattacctatcgttactactttagatgagttagacaaagaagctttaattacaatt
ttaactaagcctaagaatgccatagtaaagcaatatcagaaacaatttgagcttgatgat
gctgagcttgtaattgatgattcagccttagaaactattgccgaaaaagctctagctaaa
aagacgggagcaagaggactgcgttcaatacttgagcatcttttgcttgatagtatgtat
aaagttgccgagctcaaaaaacagcgtgttactattacaaaagaggtagttaacggctta
gtcgaaccgataatgacctctctcatttctacaaaatcaaacaaaaaacaaccgattatt
gcagatataccggcgtaa

DBGET integrated database retrieval system