KEGG   Rickettsia rickettsii Hino: RPJ_07415Help
Entry
RPJ_07415         CDS       T01738                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rrn  Rickettsia rickettsii Hino
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rrn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1251422..1252567)
Genome map
AA seq 381 aa AA seqDB search
MYINYLKDLISFKSVTPKSDGAIEYINDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSN
EPNICFVGHVDVVLEGNHELWHNASPFKVSQQDGKIYGRGAVDMKGAIACFLAASLDFIK
NNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIG
RRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGTEFFQRSNLEVTNI
EVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAES
FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY
TKISDLQKLYDVYYNFLMEIL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgattagttttaagtctgtaactcctaagagcgat
ggggctattgagtatattaatgatttgcttaaacagcacggctttaagaccgaaataaaa
atattcggtgattctaaaagtgagcaagtcactaatctttatgctgttttcggtagcaat
gagcctaatatttgctttgttggtcatgtagatgtagtgttggaaggcaatcatgagctt
tggcataatgcgagtccatttaaagttagccagcaagatggtaagatatatggcagaggt
gcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttataaaa
aataataccgattttaaaggttccattagtttcttacttactagtgatgaagagggaaaa
gcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagataaat
tttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagattggc
agaagaggaagtgttaactttaaattaaatatagaaggtttaagcgggcatgtagcttat
cctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaacaaat
ataaaacttgatgaaggtactgaattttttcaacgttcaaatcttgaagtaacgaatatc
gaggtcagtaataatacttcaaacgtaattccggccagtacggaagcatctttcaatata
cgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattattaaa
cagcattgtaaagaatataaagtagattataagttagaatatagtagttctgctgaaagt
tttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacgctt
aaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaaaat
tattgtccgttagtagagtttggtttattatccgaaacggcacataagataaacgaatac
acaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaaata
ctttga

DBGET integrated database retrieval system