KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104661151Help
Entry
104661151         CDS       T03989                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     104661151 (ABHD12)
Peptidases [BR:rro01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   104661151 (ABHD12)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   104661151 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 500 aa AA seqDB search
MATEGPAPRKESVQEQRMGKPSATSESRQVAIHLAELIEEPLTVLQMLFDGKALHSTLRV
CPSSSPPSTEAASIETGFVNTDDLDSVYPVSIFYPYTCELAPQLTLVFLNYCVSPMALSL
VAQLAQITLDSIPSSRRKSLWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRV
PYFIDLKKPQDQGLNHTYNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSH
AIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVF
DWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFS
VIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIA
APARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILSQQPGILEPRGASTCNAQEPNLH
LERTQMPGGEDPAGLQCPEA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggccacagagggacccgcaccccgcaaggaaagcgtgcaagagcagcgcatgggaaag
ccatctgccacctctgaaagcagacaggtggccatccacctggctgagctgatagaagag
cctctcacagttttacagatgctgtttgatgggaaggctctacatagcacacttagggtg
tgcccttcttcgtcaccaccaagtacagaagctgcatcaatagaaacaggcttcgtcaac
acagatgatcttgacagcgtgtaccctgtgtccatcttctacccctacacctgtgaactg
gcaccacagttaactcttgtattcctaaattactgtgtcagtccaatggccttgtccctg
gtagcccaactagctcagatcaccctggacagtatccccagcagcaggcgaaagagccta
tggttgcgcctgaggaaaatactcttctgtgttttggggttgtacattgccattccattt
ctcatcaaactatgtcctggaatacaggccaaactgattttcttgaatttcgtaagggtt
ccctatttcattgatttgaaaaaaccacaggatcaaggtttgaatcacacatataactac
tacctgcagccagaggaagacgtgaccattggagtctggcataccgtccccgcagtctgg
tggaagaacgcccaaggcaaagaccagatgtggtatgaggatgccttggcttccagccac
gctatcattctgtacctgcatgggaacgcaggtaccagaggaggtgaccaccgcgtggag
ctttataaggtgctgagttcccttggttaccatgtggtcacctttgactacagaggttgg
ggtgattcggtgggaacgccatctgagcggggcatgacctatgacgcactccacgttttt
gactggatcaaagcaagaagtggtgacaaccctgtgtacatctggggccactctctgggc
actggtgtggcgacaaatctggtgcggcgtctctgtgagcgagagacgcctccagatgcc
cttatattggaatctccattcactaatatccgcgaagaagctaagagccatccattttca
gtgatatatcgatatttccctgggtttgactggttcttccttgatcctattacaagcagt
ggaattaaatttgcaaatgacgaaaatgtgaagcacatctcctgtcccctactcatcctg
cacgctgaggacgacccggtggtgcccttccagcttggcagaaagctctatagcatcgct
gcaccagctcgaagcttccgagacttcaaagttcagtttgtgccctttcattcagacctt
ggctacaggcacaaatacatttacaagagccctgagctgccacggatactgagtcagcag
cccggcatcctggagccccggggggccagcacctgcaatgctcaggagcccaacttgcac
ctggagaggactcagatgccaggtggggaggaccctgcaggcctgcagtgcccggaggcc
tga

DBGET integrated database retrieval system