KEGG   Rickettsia rickettsii Hlp#2: RPK_01885Help
Entry
RPK_01885         CDS       T01739                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rrp00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rrp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341809..342336)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSVAVQESSANQNTTALEQ
ALVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASIADYKYSP
ALSKLGGVWDDDSLFAFLHKPSSYAPGTKMSFAGISKPQNIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatattatacaagcccactctagagttacaacatcgc
ggctacagcgttgcggttcaagaatcatcagcaaatcaaaatactaccgcactagagcaa
gcactggtaaatataccggaattaatgaagactgccaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcgagcatagcagactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaaaaccacaaaac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system