KEGG   Rickettsia rickettsii Hlp#2: RPK_03505Help
Entry
RPK_03505         CDS       T01739                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rrp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(608576..609145)
Genome map
AA seq 189 aa AA seqDB search
MSTPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAEILNTKFY
ETCNFRDFILLNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQ
EKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRH
EFLNLTAKR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccaactagagaagaagctaaagaggcagtaagaacgttactaaaattcatt
ggtgaagatccaagcagagaagggttgcttaaaacgcctgatagagtaattaatagctac
gcagaaatattttctggttatggaaaggatgtagcagaaatattaaataccaagttttat
gaaacttgtaattttcgagattttatcttactgaatataaaatttacctctttctgtgaa
catcatatattaccttttaacggtacagtagatatagcttatgttcctgataattgtatt
gtcggcataagtaagctagcacgaatagtaaatatttttgctagaagactacaaatccaa
gaaaaaatgacggtacagatagcagaaagcgtgcaggagaatttaaagccgcttggcgtt
gccgttaagatttctgccgtacatagctgtatgtcaatgcgtggcgtaatgcaagataat
agcgttatgaataccatgcattatacgggtatatttgccgaacagcagaaatatcgtcat
gagtttttaaaccttactgctaaaaggtga

DBGET integrated database retrieval system