KEGG   Rickettsia rickettsii Hlp#2: RPK_07470Help
Entry
RPK_07470         CDS       T01739                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rrp00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rrp00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262754..1262996
Genome map
AA seq 80 aa AA seqDB search
MLSVPVTSTHHLVRNQIADTAKARHISEKSALRDVILKSQATKKFVEADEIANLVIFLCD
KKASSITGSGLLIDGGWMAQ
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgctatctgtcccggttacgtcaacacaccatctagtaaggaatcaaatagcagatact
gctaaagctagacatataagtgaaaaatcagcgttaagggatgtaatccttaaatctcaa
gctacgaaaaaatttgtagaagctgatgaaatagcaaacttagtaatattcttatgtgat
aaaaaagcatcatcaataacaggtagtggactcttgatagatggcggctggatggcacag
tag

DBGET integrated database retrieval system