KEGG   Rickettsia rickettsii Hlp#2: RPK_07470Help
Entry
RPK_07470         CDS       T01739                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rrp  Rickettsia rickettsii Hlp#2
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPK_07470
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPK_07470
Enzymes [BR:rrp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPK_07470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262754..1262996
Genome map
AA seq 80 aa AA seqDB search
MLSVPVTSTHHLVRNQIADTAKARHISEKSALRDVILKSQATKKFVEADEIANLVIFLCD
KKASSITGSGLLIDGGWMAQ
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgctatctgtcccggttacgtcaacacaccatctagtaaggaatcaaatagcagatact
gctaaagctagacatataagtgaaaaatcagcgttaagggatgtaatccttaaatctcaa
gctacgaaaaaatttgtagaagctgatgaaatagcaaacttagtaatattcttatgtgat
aaaaaagcatcatcaataacaggtagtggactcttgatagatggcggctggatggcacag
tag

DBGET integrated database retrieval system