KEGG   Roseiflexus sp. RS-1: RoseRS_0099Help
Entry
RoseRS_0099       CDS       T00542                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_0099
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_0099
   00052 Galactose metabolism
    RoseRS_0099
   00500 Starch and sucrose metabolism
    RoseRS_0099
   00520 Amino sugar and nucleotide sugar metabolism
    RoseRS_0099
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RoseRS_0099
   00524 Butirosin and neomycin biosynthesis
    RoseRS_0099
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RoseRS_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
118560..119633
Genome map
AA seq 357 aa AA seqDB search
MVIRHMTQHGSLCYNCVSKPHSLALLRYRREVAMLDPTPLIQERLTHNRWGLLGGQGCVL
GFDIGSYGLRAALVDLSRHTFHAMHREPANESPQELVGGAIDLGNELMAAHGVTSAHLVR
VGAGFGGPVDVRQGIVLLSPRAPGWERYPLREALENAFGASCVVDNDANLIALAEATFGV
GRDTQHMVYIHLSTGVGAGLVLDGRLYHGATTTAGEIGHAVIGPVDPTRPGERPKTLEEH
VSIKGLLSRAAELGFHTNLLSDIFSDHPVGRQVVAEAIDVLAVRIAQIVALIDPQMVVIG
GVVARNGGEEFINAIRERMHTYIGKAVERPVQVVSAMLGADSVAIGAVALALESMRD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggtcatacgacatatgacgcagcatggttcactgtgctataattgcgtttccaaaccg
cactcgctcgcactgttgcgctatcgcagggaggttgccatgctcgatccgacgccgctc
atccaggagcgattgacacacaaccgctggggtctgctcggcggtcagggatgcgtcctc
ggtttcgatatcggcagctacggattgcgggcagcactggtggatctcagccggcacacc
tttcatgcgatgcatcgcgagccggcaaacgaatcgccgcaagaactggtcgggggcgcc
atcgatctgggaaatgagttgatggcagcgcacggtgtcacctccgcacacctggttcgg
gttggcgccggtttcggcggaccggtggatgtgcggcagggtatcgttctgctctccccg
cgtgcgccgggctgggaacgttacccgctgcgtgaagcgctcgaaaacgcttttggcgcc
tcgtgcgtggtcgataacgatgccaacctgatcgctctggcggaagccacatttggggtt
gggcgcgacacccagcacatggtgtatattcacctgagtaccggtgttggcgccggattg
gtgctcgacgggcgcctgtaccacggcgcaacgacaaccgccggagagatcggacatgcg
gttatcggtccggtggatccgacccgtcccggtgaacggcccaaaacgctggaagagcac
gtatcgatcaaggggttgctgagtcgcgcggcagaactcggcttccacacaaacctgttg
agcgacatcttcagcgatcatccggtggggcgtcaggttgtcgccgaagcgattgacgtg
ctggcagtacggatcgctcagatcgtcgcactcatcgacccgcagatggtggtcatcggc
ggggttgtggcgcgcaacgggggcgaggagttcatcaacgccatccgggaacggatgcac
acctatatcggtaaagcggtcgaacgaccggtgcaggtggtctccgccatgttgggcgcc
gacagtgtggcaatcggggcagtggcgctggcgctcgagagcatgcgcgattga

DBGET integrated database retrieval system