KEGG   Roseiflexus sp. RS-1: RoseRS_0349Help
Entry
RoseRS_0349       CDS       T00542                                 

Definition
(GenBank) peptidase M42 family protein
Organism
rrs  Roseiflexus sp. RS-1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
445412..446470
Genome map
AA seq 352 aa AA seqDB search
MNDHSLAFLKHLLATPGPSGDEVAVGRIWRREAETFADRVYADVRGNSYAVLEGGSPRVL
LAGHIDEIGVMVSSIDDDGFLWFSPIGGWDPQVLVGQRVRLAGRTGDVIGVIGKKPIHQM
KPDEREKASKIEDLWIDIGVTSRAEARELVRVGATGVIDAPIYDLPGGRIVSRSIDDRIG
AFTVLEALRLLERDRPRATVAAVATSQEEITFAGAHTAAFSFEPQVAIAVDVTFATDHPN
ADRRQYGNVRLGGGPVLSRGSANSPVVYDMLTAIAEREGIPYSIQVNPRYTGTDADAIHL
SRGGVATAVISIPNRYMHSPNEMIALSDVEYAARLIAAFVRSLTPETSFIPI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccattcgcttgcatttttgaaacatctgcttgccacgcccggtccctccggc
gatgaagtggctgtcgggcgcatctggcggcgcgaagccgaaacctttgccgatcgggtc
tacgccgatgtgcggggcaattcgtatgccgtgctggaaggcggatcaccgcgtgtgctg
cttgccggtcatatcgacgagatcggcgtcatggtgagttccattgatgacgacggcttt
ctgtggttctcgcccatcggcggatgggatccgcaggtgctggtcgggcagcgggtgcgt
ctggcggggcgcaccggtgatgttattggcgttatcgggaagaaaccgatccatcagatg
aaacccgacgagcgcgagaaagccagcaagatcgaggacctctggatcgacatcggcgtg
acgagtcgggcggaagccagagaactggtgcgtgtcggcgccaccggcgtgatcgatgcg
ccgatctacgatctgccgggcgggaggatcgtttcacgcagcatcgacgaccggattggc
gcattcacggtactggaggcgctccgcttgctggagcgcgatcgtccgcgcgcaacggtg
gcggcagtggcaacgtcgcaggaggaaatcacgtttgccggcgcgcataccgcagccttc
agtttcgagccgcaggtcgctattgcggttgatgtgacctttgcaactgaccatccgaac
gccgaccgccggcagtatggcaatgtgcggcttggcggcggaccggtgctgtcgcgcggt
tctgccaatagtccggtggtgtacgatatgctgacggcgattgcagaacgcgagggcatt
ccatacagcatccaggtgaatccgcgctacaccggaaccgatgccgatgccattcacctg
tcgcgcggcggggtcgccactgctgtgatctcgatccccaaccgttatatgcactctccg
aatgaaatgatcgctctgagcgatgtcgagtatgccgcacgtctgatcgctgcattcgtg
cgcagtctgacgccggagaccagttttatcccgatctga

DBGET integrated database retrieval system