KEGG   Roseiflexus sp. RS-1: RoseRS_0349Help
Entry
RoseRS_0349       CDS       T00542                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RoseRS_0349
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RoseRS_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
445412..446470
Genome map
AA seq 352 aa AA seqDB search
MNDHSLAFLKHLLATPGPSGDEVAVGRIWRREAETFADRVYADVRGNSYAVLEGGSPRVL
LAGHIDEIGVMVSSIDDDGFLWFSPIGGWDPQVLVGQRVRLAGRTGDVIGVIGKKPIHQM
KPDEREKASKIEDLWIDIGVTSRAEARELVRVGATGVIDAPIYDLPGGRIVSRSIDDRIG
AFTVLEALRLLERDRPRATVAAVATSQEEITFAGAHTAAFSFEPQVAIAVDVTFATDHPN
ADRRQYGNVRLGGGPVLSRGSANSPVVYDMLTAIAEREGIPYSIQVNPRYTGTDADAIHL
SRGGVATAVISIPNRYMHSPNEMIALSDVEYAARLIAAFVRSLTPETSFIPI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccattcgcttgcatttttgaaacatctgcttgccacgcccggtccctccggc
gatgaagtggctgtcgggcgcatctggcggcgcgaagccgaaacctttgccgatcgggtc
tacgccgatgtgcggggcaattcgtatgccgtgctggaaggcggatcaccgcgtgtgctg
cttgccggtcatatcgacgagatcggcgtcatggtgagttccattgatgacgacggcttt
ctgtggttctcgcccatcggcggatgggatccgcaggtgctggtcgggcagcgggtgcgt
ctggcggggcgcaccggtgatgttattggcgttatcgggaagaaaccgatccatcagatg
aaacccgacgagcgcgagaaagccagcaagatcgaggacctctggatcgacatcggcgtg
acgagtcgggcggaagccagagaactggtgcgtgtcggcgccaccggcgtgatcgatgcg
ccgatctacgatctgccgggcgggaggatcgtttcacgcagcatcgacgaccggattggc
gcattcacggtactggaggcgctccgcttgctggagcgcgatcgtccgcgcgcaacggtg
gcggcagtggcaacgtcgcaggaggaaatcacgtttgccggcgcgcataccgcagccttc
agtttcgagccgcaggtcgctattgcggttgatgtgacctttgcaactgaccatccgaac
gccgaccgccggcagtatggcaatgtgcggcttggcggcggaccggtgctgtcgcgcggt
tctgccaatagtccggtggtgtacgatatgctgacggcgattgcagaacgcgagggcatt
ccatacagcatccaggtgaatccgcgctacaccggaaccgatgccgatgccattcacctg
tcgcgcggcggggtcgccactgctgtgatctcgatccccaaccgttatatgcactctccg
aatgaaatgatcgctctgagcgatgtcgagtatgccgcacgtctgatcgctgcattcgtg
cgcagtctgacgccggagaccagttttatcccgatctga

DBGET integrated database retrieval system