KEGG   Roseiflexus sp. RS-1: RoseRS_0705Help
Entry
RoseRS_0705       CDS       T00542                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RoseRS_0705
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RoseRS_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
877861..878541
Genome map
AA seq 226 aa AA seqDB search
MAFRNSTNGYHTDHALADDDGQEYETLIVQGRGKLEGVSYQSDPAIEDAVRVILKQIGEN
PEREGLLKTPSRVAKMYAELTAGYHIDPDALINDAIFSVSYDEMVLVKNIEFASLCEHHM
LPFMGRVHVAYIPNGKVVGLSKIPRIVEMFARRLQVQERMTVQIADFINQRLEPLGVAVV
AEGVHMCAVMRGVKKAGATMVTSAMRGVFRDDPKTRSEFMAHIERA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcattccgtaatagcacgaatggttatcataccgaccacgcgctcgcagacgacgat
gggcaggaatacgaaacgctcatcgttcaggggcgcggcaaactcgagggcgtgagttac
caatccgacccggcaatcgaagacgcagtgcgcgttattctgaaacagatcggcgaaaac
cccgaacgtgaagggctgctgaaaacgccgtcgcgcgtcgccaaaatgtacgccgaactg
actgccggctaccatatcgatcccgacgcgctgatcaacgacgcgatcttcagcgtcagt
tacgacgaaatggtgctggtcaagaacatcgagttcgccagcctgtgcgaacatcatatg
ctgcccttcatggggcgggtgcacgtcgcgtacattcccaacggcaaagttgtggggttg
agcaagatcccgcgcatcgttgagatgttcgcgcgtcgcctgcaggtgcaggagcgcatg
acggtgcagatcgccgattttatcaatcagcggctcgaaccgcttggcgtggcggtcgtc
gctgaaggtgtgcatatgtgcgctgttatgcgcggcgtgaaaaaagccggcgccaccatg
gtcacgtcggcaatgcgcggcgtgttccgcgacgatcccaagacgcgcagcgaattcatg
gcgcatatcgagcgcgcctga

DBGET integrated database retrieval system