KEGG   Roseiflexus sp. RS-1: RoseRS_0752Help
Entry
RoseRS_0752       CDS       T00542                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    RoseRS_0752
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_0752
  Lipid metabolism
   00071 Fatty acid degradation
    RoseRS_0752
  Amino acid metabolism
   00350 Tyrosine metabolism
    RoseRS_0752
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RoseRS_0752
   00626 Naphthalene degradation
    RoseRS_0752
Enzymes [BR:rrs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RoseRS_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(931815..932840)
Genome map
AA seq 341 aa AA seqDB search
MTTMKAAVVHDFHQPLRIEELPKPEPGFGEIVVKIEASGLCHTDIHAAHGDWPVKPKLPF
IPGHEGVGIVESVGAGVTNVKEGDRVAIPWLGYACGDCKYCASGWETLCERQLNTGYFLD
GAYAQYAKAYAKYVGIVPAGVSALDAAPLTCAGVTTYKAVKVSGARPSELVAVFGVGGLG
HLALQYAKIAGATVAAIDLLDERLQTARELGADITINASTHDPVEELKKWGGADAAICVA
VSPKAFEQAYRSLRRGGRLVFVALPADNYIQLPIFETVLNGIHVIGSIVGTRADLAETFA
LHAAGKTRVLFETRALDQVNEAFKDVEHGRNKAPRIVFSEF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatgaaggccgccgttgtccacgacttccatcaaccgttgcgtatcgaggaa
ttacccaagcctgagccaggattcggcgagattgtggtcaagatcgaagcgtcaggtcta
tgtcacaccgatatccacgcggcgcacggtgactggcccgtgaaacccaaactcccgttt
attccggggcacgaaggggtaggtattgtcgaaagcgtcggagcgggtgtcaccaacgtg
aaggaaggcgaccgcgtggcaattccctggttgggttatgcctgcggcgattgcaaatac
tgcgcttcaggttgggaaacgctctgcgaacgtcagttgaataccggttatttcctcgat
ggcgcctatgcccagtatgctaaggcctatgcgaagtacgtgggcatcgttcctgcgggt
gtttctgcactcgatgccgcgccgctgacctgcgccggcgtcacgacgtacaaagcggtg
aaggtttccggggcgcgcccttcggagttggtggccgtctttggcgtcggcggattgggg
cacctggcgttacagtatgccaaaattgccggggcaacggtggcagcgatcgacctgctc
gatgagcggttgcagacggcgcgcgaactcggcgccgatattacgatcaacgccagcacg
catgatccggtcgaagaattgaagaaatggggcggcgccgatgccgcgatctgcgtggcc
gtctcgccgaaggcgttcgagcaagcctaccgatcattgcgacgcggcgggcgactggtg
ttcgtggcacttcctgccgataactacatccagttgcctatcttcgagacggtgctcaac
ggcatccacgtcatcggctcgattgtcggcacccgcgcagacctggcggaaacgtttgca
ttgcatgccgccggaaagacgcgcgtcctctttgaaacgcgcgcgctcgatcaggtgaac
gaggcgttcaaggatgtcgagcatggacgcaacaaggcgccgcggatcgtcttctctgag
ttttga

DBGET integrated database retrieval system