KEGG   Roseiflexus sp. RS-1: RoseRS_0794Help
Entry
RoseRS_0794       CDS       T00542                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rrs00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rrs00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
984796..986325
Genome map
AA seq 509 aa AA seqDB search
MRLHEILKHLCEPAHMPPVNPEIAGVVYDSRAVTPGALFVAYRGFHTDGHAYIPQALERG
AAAVVYEDPAWDGRVPVPALRVPNARVALAPLAAAFYGHPGRRMRIVGVTGTDGKTTTTF
LTSVALEAGGAITGLMGTVDFKIGERMWTNDSRQSTPEAPEVQALLRDMAEAGCSYAVIE
ATSHALSARWNRLAGSAFDIAVFTNVTQEHLDFHGTVEQYRRDKARLFEMLAEFNDAAAP
FKQRKIAVVNADDPHHRMFLDAAPVSAERLTYAVHAHADVRAEDVRSTRDGLRFRVTTPW
GAADARLRLTGDFNVWNALAALTVACAEGVPLERCLAALERVPGVRGRMERIEAGQPFTV
LVDYAHTPGAFEKLFRIVRPLTEGQVIAVFGSAGERDRAKRPLQGEIAGRFCDLVIVTDE
DPRLEDRAAIIAEIAAGAEAVGKRIGETCLCIPDRALAIRTAFAYARPGDIVLLLGKGHE
GSIIYGTTPVPWDEAAEARRALAELGYGG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctccacgagatactgaagcatctgtgcgaacctgcgcatatgccacctgtcaac
ccggagatcgccggcgttgtgtacgactcgcgcgccgtgactccaggggcgttgtttgtg
gcgtatcgcggctttcataccgatgggcatgcctacattccgcaggcgctcgaacgtggc
gcggcggctgtggtgtacgaagaccctgcgtgggacggtcgcgtgccggttccggcgttg
cgcgtaccgaatgcgcgcgtcgcgctggcgccgcttgcagcagccttctacgggcatccc
ggtcggcgcatgcggatcgttggcgtgaccggcaccgacgggaagaccaccacgacattc
ctgaccagcgtggcgctcgaagccgggggcgccatcaccggtttgatgggcacggtcgat
ttcaagatcggtgagcgcatgtggaccaacgactcacgccagagcacgccggaagcgccg
gaggttcaggcgctgctgcgggatatggcagaagcgggttgcagctatgcggtcatcgag
gcgacgtcgcacgcgctctcggcgcgctggaatcgactcgccggaagtgcattcgatatt
gctgtattcacgaatgtgacgcaggagcacctcgattttcacggcacggtcgagcagtat
cgccgcgacaaagcgcgcctgttcgagatgctggcggagttcaacgatgctgccgcgccg
ttcaagcagcgcaagatcgcggttgtgaacgccgatgatccgcatcatcgcatgttcctc
gacgcggcgccggtatctgcggaacgtctgacctatgcggttcacgcgcatgccgacgtg
cgcgcagaagatgtccgttcgacccgcgacgggctgcgctttcgggtgacgacgccatgg
ggcgctgcggatgcacgattgcgcctcaccggcgacttcaatgtctggaatgcactggca
gcattgactgtcgcctgcgccgagggtgtgccgcttgagcgctgccttgcggcgctggag
cgcgtgcccggcgtgcggggacgtatggaacggatcgaggcaggacagccgttcaccgtg
ctggttgattatgcgcacacccccggcgcattcgagaaactgttccgcattgtgcgtcca
ctcaccgaaggacaggtgattgcggtctttggcagcgccggagaacgcgaccgcgccaaa
cgcccgttgcagggggagattgcaggacgcttttgcgacctggtcattgtgaccgacgaa
gatcctcgcctggaggatcgtgccgcgatcatcgccgaaatcgccgctggcgccgaagct
gtcggtaaacggatcggcgaaacctgtctgtgtattccggatcgcgccctggcaattcgt
actgcatttgcgtatgcacgccctggcgatattgtgctgctcctcggcaagggtcacgag
ggaagcatcatctacgggacaacgccggttccctgggatgaagcggcggaggcgcgacgc
gcgctggcggaattgggatatggcggataa

DBGET integrated database retrieval system