KEGG   Roseiflexus sp. RS-1: RoseRS_1012Help
Entry
RoseRS_1012       CDS       T00542                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_1012
   01230 Biosynthesis of amino acids
    RoseRS_1012
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_1012
  Energy metabolism
   00680 Methane metabolism
    RoseRS_1012
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RoseRS_1012
Enzymes [BR:rrs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     RoseRS_1012
Exosome [BR:rrs04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   RoseRS_1012
  Exosomal proteins of melanoma cells
   RoseRS_1012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1238552..1239079)
Genome map
AA seq 175 aa AA seqDB search
MLNELFLIRHAAPDRTTGLPYTVMPGPPLTLRGEEEAVQAGHWLRDRGIERLLSSPFTRT
VATATVIGQLIGLTPTVIEALREVAPGEQHSEVRARIADLLNQLDDTPLQRVALVTHGGC
ILAALHYTTGDRIDLSGHRYDNGNHAPTAGIWHGVRTDQGWRWSLAFRPDMAVES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgaactgtttttgatccgacatgccgcgccggatcgcacaaccggattgccc
tacacagtgatgccaggtccgccattgacgctgcgcggtgaggaagaggcagtgcaggcg
gggcactggctgcgagatcgtggtatcgaacgtctgctttcgtcgccgttcacccgcacg
gttgcaacggcaacggtgatcgggcaactgatcgggctgacgccgaccgttatcgaggcg
ctgcgtgaagttgcaccgggtgagcagcattcagaggtgcgcgcccggatcgccgatctc
ctcaatcaactcgacgacacgccgttgcagcgtgtggcgcttgtgacccatggcggttgc
atcctggctgcgctgcactacacaaccggcgaccgtatcgatctgagcgggcatcggtac
gataacggcaaccacgccccgaccgccggaatctggcatggcgtgcgcaccgatcagggg
tggcgctggtcgctcgcgttccgcccggatatggcggtggagagttga

DBGET integrated database retrieval system