KEGG   Roseiflexus sp. RS-1: RoseRS_1136Help
Entry
RoseRS_1136       CDS       T00542                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:rrs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1419365..1420120
Genome map
AA seq 251 aa AA seqDB search
MNDGIRIIPVRGIGDVQPGDDLASVLVGALTRNDIVLENGDVLVVTQKIVSKAEGRLVNL
QTVEPSHLARMAALQGRKDAAYYEVVLRESRRIVRMDRGVLITETHHGFICANAGVDESN
VAGGRFVTLLPTDPDASAARLRQALLERYNLEVAVIISDTFGRPWREGQVNVAIGAAGIA
PLVDYAGQQDAYGYTLHASVIAVADELASAAELVMGKADQIPVAVVRGYRVVHSDVGARA
LIRAPERDLFR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatggtattcgtatcatccctgttcgcggcatcggcgatgtgcagcctggtgat
gacctcgccagcgttcttgtcggtgcacttacgcgcaacgatatcgtgttggagaatggg
gatgtgctggtcgttacccagaagattgtttctaaagcggaaggtcgcctggtaaatctg
caaacagtcgagccgtcgcatctggcgcgtatggctgcgttgcaggggcgaaaagatgca
gcatactacgaagtggtgttgcgcgagagccgacgtattgtcaggatggatcgtggtgtg
ctgattactgaaactcaccacgggtttatctgcgcgaatgctggagtcgatgagtcgaat
gtggcgggcgggcgttttgtgacgttgctgccgaccgatccggatgcgtcagcggcgcgc
ttgcgtcaggcactgcttgaacgctacaatcttgaggtggcagttattatttcggataca
tttgggcgtccatggcgcgaagggcaggtaaatgtcgcaattggcgccgcaggcattgcg
ccactggttgattatgcaggtcagcaggacgcatatggctataccctgcacgcaagcgtc
atcgcggtagctgatgagttggcttcggctgcggagttggtgatgggaaaggcggatcag
atacctgtcgcggttgtgcgagggtatcgtgttgtgcactccgatgtgggtgcacgagca
ttgattcgtgcgcccgaacgcgatctgtttcgttaa

DBGET integrated database retrieval system