KEGG   Roseiflexus sp. RS-1: RoseRS_1498Help
Entry
RoseRS_1498       CDS       T00542                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RoseRS_1498
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RoseRS_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1824459..1824899)
Genome map
AA seq 146 aa AA seqDB search
MNRTYTITFACLMALVLALSACGGQSGPAPSAAAEPLARTISANGDPEKGRLYYENQGGC
LACHSTGVDKLVGPGLAGVMTTAGPVYPEGVNYRGNLPNGQPRTEENIAAWIRSGGQGQI
GVMSPHEMSDEDMANLLAYLHTLKRP
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcacatatacaatcacatttgcctgtctgatggctctggtgctggcgctatcc
gcatgcggcgggcagagcggacctgcaccgagtgcagcggcagaaccgctggcacgcaca
atctcagccaatggcgaccctgagaagggcaggctctactacgagaaccaagggggatgc
ctggcatgccactcgaccggcgtcgataaactggtgggaccagggcttgctggtgtgatg
acaaccgcaggtccggtctaccctgaaggggtcaattaccgcgggaacctgccaaatggt
cagccgcgcactgaggagaacatcgcggcgtggatccgcagcggcggtcaggggcagatt
ggcgtgatgtcgccccacgaaatgagcgacgaagacatggcgaatctgctggcatacctg
cacaccctgaagcgaccgtag

DBGET integrated database retrieval system