KEGG   Roseiflexus sp. RS-1: RoseRS_1533Help
Entry
RoseRS_1533       CDS       T00542                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rrs03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1874007..1874624)
Genome map
AA seq 205 aa AA seqDB search
MHQTHDIQILPAPVIRLIEELNRLPGVGPKTASRLTFFLLRAPDDLPLALAHALTALKQQ
VQLCSRCYFITQGDLCAICANPARDQRVICVVEEPLDVVAIERTGVYRGLYHVLHGRIAP
LEGMNREDIYFDELLDRVRAEPVEEVIIATNPNLEGEATAFHLQRALAPLGVRVTRLARG
LPTGGDLEWADPGTLGSALEGRREM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagacgcacgacatccagatcctgcccgcgccggtcatccgtctgatcgaggag
ctcaaccggttgcccggcgtaggtcccaaaacggcatcgcgcctgaccttcttcctgctg
cgtgcgcccgatgacctgccgcttgccctggcgcacgctctgacagcgttgaagcaacag
gtgcagttgtgttcgcgctgctatttcatcacccagggtgatctgtgcgccatctgcgcc
aaccctgcacgtgatcagcgtgttatttgcgtggtcgaagaaccgctcgatgtggtggcg
atcgaacgcactggcgtgtaccgtgggttgtaccacgtgctgcatgggcgcattgcgccg
ctcgaagggatgaaccgcgaggatatctactttgacgaactcctcgaccgggtgcgcgcc
gagccggttgaggaggtgattatcgccaccaatccgaacctggaaggcgaagcgacagca
tttcacctgcaacgcgccctggcgccgctcggcgtgcgcgtgacccgcctggcgcgcgga
ttgcccaccggcggcgacctggagtgggccgaccccggcacgctgggttcggcgctcgaa
gggcggcgcgagatgtag

DBGET integrated database retrieval system