KEGG   Roseiflexus sp. RS-1: RoseRS_1575Help
Entry
RoseRS_1575       CDS       T00542                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RoseRS_1575
Enzymes [BR:rrs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     RoseRS_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1924794..1926332
Genome map
AA seq 512 aa AA seqDB search
MNRQRASGILLHPTSLPSRWGIGDLGDGAYDFADLLAAAGQRIWQVMPLGPTGYGDSPYQ
SFSAFAGNPLLINFDILLEEMLLTPSDLADAPILPDTSVNYGAVIPFKNQILRRAFARFR
EGYADHLRADFEAFCEAQASWLDDYALFAALKSANGGGPWSDWEPDLRRRDPAALAAARR
AYADEIAYQRFIQYLFFDQWLALKKYVNDLGIQIMGDIPIFVAYDSADVWAHPELFFLDD
EGRPTVVAGVPPDYFSATGQLWGNPLYRWDVLKERGYDWWIERFRTTLTMVDIVRLDHFR
GFAAYWEVPADEETAVNGRWAPGPGADFFEAVKRALGTLPIVAEDLGVITPDVEALRDQF
GFPGMRVLQFAFGGKADQPYLPHNHIQRCVVYTGTHDNDTTLGWWRTASDQERRHVQLYL
GRSGEDIAWDFIRAALSSVADTAIIPLQDVLSLGSEARMNTPGRPGGNWTWRFGLHQLTP
AVISRLRELTILYGRYVEPEPKQKSEEDVVEH
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccaacgagccagcggtattctgctccatccaacgtcgcttccgtcgcggtgg
ggtatcggcgacctgggtgatggagcatacgactttgccgatctgcttgccgccgcaggt
caacgtatctggcaggtgatgccgctgggtccgaccggctacggcgactcgccgtaccag
agtttctctgcgtttgccggcaatcccctgctgatcaacttcgacatcctgctcgaagag
atgttgctcacgccgtcggacctggctgacgcgccgattctgccggatacatcggtgaat
tatggcgcagtcattccgttcaagaaccagattctgcgccgcgcattcgcgcgcttccgc
gaaggatacgccgaccatctgcgcgccgatttcgaggcgttctgtgaagcccaggcatcc
tggctcgacgactacgccctctttgccgcattgaagagcgccaacggcggcggtccgtgg
tccgactgggaaccagacctgcgcagacgcgacccggcggcgctcgctgccgcgcgtcgt
gcgtatgccgacgaaatcgcctatcagcgtttcatccagtacctctttttcgaccagtgg
cttgcgctgaagaagtatgtcaacgatctggggatccagatcatgggagacattccgatc
ttcgtcgcctacgacagcgccgatgtctgggcgcatcctgagttgttcttcctcgacgat
gaggggcgaccgacggttgtagccggcgtaccgccggattacttcagcgcaaccgggcag
ttgtgggggaatccgttgtatcgctgggacgtactgaaagaacgcggctacgactggtgg
atcgaacggttccgcaccacgctcacgatggtcgatattgtgcgtctcgatcatttccgt
ggctttgctgcctactgggaagtgcctgccgatgaggagacggcagtcaatggtcgctgg
gcgccaggacccggcgccgacttcttcgaggcggtcaaacgggcgcttggcacgttgccg
attgtggcggaagacctgggagtcattacgcctgacgtcgaagcgctgcgcgatcagttc
ggctttcccggcatgcgcgtgttacagtttgcctttggcggcaaagccgatcaaccctac
ctgccgcacaaccacattcaacgctgcgtggtctacaccggcacacacgataatgacacg
acgcttggttggtggcgcactgcttcggatcaggagcgccgccatgttcagctctacctg
gggcgcagcggcgaagatattgcgtgggatttcatccgcgctgcgctgtcgtcggtggca
gacaccgccattatccccctgcaggatgtcctgtcgctgggaagcgaggcgcggatgaac
acacccggacgaccgggcggaaactggacgtggcgcttcggattgcaccagttgacaccg
gcggtcatctcgcgtctgcgtgaactcaccatcctctacgggcggtacgtcgagccggaa
ccgaagcaaaaaagcgaggaggatgttgtcgaacattga

DBGET integrated database retrieval system