KEGG   Roseiflexus sp. RS-1: RoseRS_1675Help
Entry
RoseRS_1675       CDS       T00542                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_1675
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RoseRS_1675
  Amino acid metabolism
   00310 Lysine degradation
    RoseRS_1675
Enzymes [BR:rrs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RoseRS_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2067794..2069098)
Genome map
AA seq 434 aa AA seqDB search
MAVDIVLPQIGESMTEATIGRWLKRVGDRVERYEALVEVETDKVSTEVTSITSGVLLEIA
TPEGATVPVGALLARIGEPGEAAVSNAPEAGAGTAATTVTTDAPEPARPRRADGPPITPV
VARLAAEYGIDLSQIRGTGAGGRVSKKDVLRYIEERQKAAATPPPAPVAPPQPLPTTVAP
PVPPPTPAAPPTPTRTPVAQPLPDDALLTPLTTMRRVIADHMVRSLRDAPQATTVFEVDM
GRVLAHRERYRSSFEQQGIRLTVTAYIVQAVATALRRVPALNTRFTDDGIITYRRIHIGI
AVALDDGLIVPVLRDADEKSLAGIARALNDLTERARMRRLQPDETEGGTFTISNHGVGGS
LFATPILNRGQSGILGVGAIVKRPVVITHQGSDAIVIRPMCYLSLTFDHRACDGATADAF
LAAVKETLEAYPEQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgatattgttctgccgcagatcggcgaaagcatgaccgaagcgacgatcggg
cgctggctcaagcgcgtcggcgaccgcgtcgaacgatacgaagcgctcgtggaagtcgaa
acggataaggtctcgaccgaggtgacatcgatcaccagtggcgtcctgcttgaaatcgct
acgccagaaggcgccaccgtgccggtcggcgccttgcttgcccggatcggcgagccgggt
gaagcggcagtgagcaacgctccagaagcaggcgccgggacggcggcaacgacggtgacg
acggatgctccagagccagcgcgtccccgccgcgctgacggtccgccgatcacgccggtt
gttgcccgtctcgccgccgagtacggcatcgatctgagccagatccgcggcaccggcgct
ggcgggcgcgtcagcaagaaggacgtgctgcgctatatcgaggagcgacagaaggctgcc
gccacgcctccacccgcaccggttgcaccgccccaaccgctcccgacaacggtcgcgccg
cctgtgcctccaccgacaccagcagcgccaccgacgccaacgcgcactcccgtcgctcaa
ccgctgcccgatgatgccctcctcacgccgttgacgacaatgcgccgcgtgattgccgac
catatggtgcggtcgctccgcgacgctccgcaggcaacgacggtctttgaggtcgatatg
gggcgggtgctggcgcaccgcgagcgctaccgcagttcgttcgagcagcaggggattcgt
ctgaccgtgaccgcctacatcgtgcaggcggttgcaaccgcgttacgccgcgttccggcg
ctgaatacccggtttaccgacgatgggatcatcacctaccggcgtatccatatcgggatt
gcggttgcgctcgatgatggactgatcgtaccagtgctgcgcgacgccgatgagaaaagc
ctggcggggattgcgcgcgcgctgaacgacctgaccgaacgtgcgcgtatgcgtcggtta
cagccggatgagaccgagggcggaaccttcaccatttccaaccatggcgttggcgggagc
ctgttcgcaacccctattcttaatcgcgggcagagcggtattcttggcgtcggcgcgatt
gttaagcgtccggtggttatcacccatcaggggagcgacgcgattgtcatccgtccgatg
tgttatctgtcgctcacgttcgaccatcgcgcctgtgatggcgccactgccgacgcattc
ctggcagcggtcaaagagacgcttgaagcctatcccgaacagtga

DBGET integrated database retrieval system