KEGG   Roseiflexus sp. RS-1: RoseRS_1704Help
Entry
RoseRS_1704       CDS       T00542                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrs01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rrs00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2099295..2100404)
Genome map
AA seq 369 aa AA seqDB search
MNDASLRREITDLACDLIAFESTADHPSELKAAIDYVEQYARQIDGVLIRRYEVEQKPGL
MVTLRDTHTPALLLNGHLDVVAARAEQYRPVVRDGRIYGRGSQDMKGACAVLMRLMKDLA
AAPQPPDVGFMYVTDEEIGGFHGTSYLLEQGWRTRFFIAAEPTDLNICYAAKGMVRFDVT
LHGKPAHGSRPWDGVNPILLLRDGLQALERRFPTPTEAVWATTAVPTVVRGGETLNRIPE
TVTLSLDIRHIPEETPDEIEAAVRACFPGATVVRNSNGGIPLLTDPNDPHLARLAASVER
ITGRQPAFYREHYGSDARFYSGAGIPAICFGPVGAGLHSDEEWVDIASLERLYRILYDFA
RVAAHEDQE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatgcctcgttgcgacgtgagatcaccgacctcgcctgtgacctgattgccttt
gagtcgactgccgaccatccatcagaattgaaggcagcgattgattatgtcgagcaatac
gcccgtcagatcgacggagtattgatccggcgatacgaggttgaacagaagccaggtctg
atggtgacgctgcgcgacacgcacacgccagcgcttctgctcaacggacacctcgatgtg
gtcgctgcgcgtgcagagcaataccgtcccgttgtgcgcgacgggcgcatctacggtcgc
ggcagtcaggatatgaaaggcgcatgcgctgtgctcatgcggctgatgaaagacctggct
gcggcgccccaaccgcccgacgttggctttatgtatgtcactgatgaggagatcggcggc
ttccacggaacgagttatctgctggagcaggggtggcgcacccgcttcttcatcgctgcg
gaaccgaccgacctcaacatctgctatgcagcaaaaggcatggtgcggttcgatgtcaca
ctccatggcaaaccggcgcacggttcgcgtccgtgggatggagtcaacccgatcctgctg
ctgcgcgacgggttgcaggcgctcgaacgacgcttccccacccccacggaagcagtctgg
gcaacgaccgccgtgccgaccgtagtgcgtggcggcgagacgctcaaccgcattcctgag
accgtcaccctctcgctcgatattcgccacattcctgaagaaacccctgacgagatcgaa
gctgctgtgcgcgcctgtttccccggcgcgactgtggttcgcaacagcaacggcggcatc
ccgctgctgaccgaccccaacgacccgcaccttgcgcgccttgctgccagcgtcgagcgc
atcaccgggcgccagccagcattctaccgtgagcattacggttcagacgcccggttctac
agcggcgctggcattccggcgatctgtttcggaccggtgggcgccggattgcactccgat
gaagagtgggtcgatattgccagtctggagcgcctctaccggattctgtacgatttcgca
cgggtggcggctcatgaagatcaggaatag

DBGET integrated database retrieval system