KEGG   Roseiflexus sp. RS-1: RoseRS_1751Help
Entry
RoseRS_1751       CDS       T00542                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RoseRS_1751
Enzymes [BR:rrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RoseRS_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2163706..2164488
Genome map
AA seq 260 aa AA seqDB search
MKAVGRLQGKRIAVTRAAERAEGLASALRAEGAEVSICPTIAYAPPEDPAPLEAALRRLD
RYDWIVFTSAAAVDALAEQGALPPPAHVRVAAVGKATAASIEARGGRVDLIPAEQNAEGL
LAALHDVAGKRFLLPVADIARDALAAGLRARGAVADMVIAYRTVPGPGARELITLLCGRA
LDAILFSSPSTLRYLLDGMEQFGIDRSVARALLTGVALIAIGPTTARALRDEGLPVAAQA
PTPDTGGVLQALYDGLAEKG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttggtcgattgcagggcaaacggattgcggtcacccgcgccgccgaacgc
gccgaaggtctggcgtcggcgttgcgcgcggaaggcgcggaggtgtcgatctgcccaacc
attgcctatgctccgccagaagatccagcgccgctcgaagcagcgttgcgacggcttgat
cggtacgactggattgttttcaccagcgcggctgcggttgatgcgctcgcagaacagggg
gcgctgcccccgcctgcgcacgtgcgcgtggcagcggtcggcaaagcaaccgctgcatca
atcgaagcgcgtggcgggcgggtcgatctgatccccgccgaacagaatgcggaggggttg
ctggcggcgctgcacgatgtcgctggcaaacgttttctcctgcctgttgccgacattgcg
cgcgacgcactggctgccggtcttcgcgcgcgtggggctgtggcggatatggtcatcgcc
tatcgaacggttcctggtccaggggcgcgtgagttgatcacgctgctctgcgggcgtgcg
ctcgatgcaattctgttcagcagcccatcgacgctgcgctacctgctcgatggcatggaa
cagttcggcatcgaccgttcggttgcgcgggcgctgctgactggcgtggcgctgatcgct
atcggaccgacaacggcgcgggcgttgcgggatgaagggttaccggttgcagcgcaggcg
ccaacgccagataccggaggcgtgcttcaggcgttgtatgatgggctggcagaaaaaggt
taa

DBGET integrated database retrieval system