KEGG   Roseiflexus sp. RS-1: RoseRS_1752Help
Entry
RoseRS_1752       CDS       T00542                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00860  Porphyrin and chlorophyll metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RoseRS_1752
Enzymes [BR:rrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     RoseRS_1752
Exosome [BR:rrs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RoseRS_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABQ90142
UniProt: A5UU39
Position
2164507..2165490
Genome map
AA seq 327 aa AA seqDB search
MLIQRPRRLRRTPALRRMVRETTLSVDHLIAPLFIAAGSGIVRPIRSMPGHAQLSVDQLD
LEINEIAELQIPAVLLFGIPAHKDPIGSSGWDPEGPVPQAIRAIKQRAPQLTVIADVCVC
EYTSHGHCGILAETPGSGDVLNDPTLDILARCAVAYADAGADIVAPSAMMDGQVAAIRSA
LDAAGHTQVAILSYAAKFASAFYGPFREAAESTPAFGDRRAYQMDPANGREALREVDLDV
AEGADMIMVKPAGAYLDIISAVRQRYHLPLAAYQVSGEYAMIKAAAQLGWLDERRAALES
LIAIRRAGADMIITYFAKDAARWIATE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgatccagcgtccgcggcgattgcgccgcacaccggcgctgcgtcgcatggtgcgc
gaaacgacgctcagcgtcgaccatttgattgcgccgctcttcattgccgccggcagcggc
attgtgcgcccgatccgctcgatgccgggtcatgcccagttgtctgtcgatcaactcgat
ctcgaaatcaacgagattgccgaactccagataccggcggtgctgctcttcggcattcca
gcgcacaaagatccgatcggtagcagcggatgggatccagaaggaccggtgccgcaggcg
atccgcgcgatcaaacaacgcgccccgcaactgaccgtgattgcagatgtatgcgtctgt
gaatacaccagccacggtcactgcggcattctggcagaaacgcccggcagcggcgatgtg
ctcaacgatcccacgctcgacatcctggcgcgctgtgcggttgcgtatgccgacgctggc
gccgacatcgttgctcccagcgcgatgatggatgggcaggtcgctgccattcgctccgcc
ctcgatgctgccggtcatacccaggtggcgatcctttcgtatgccgccaaattcgcctcc
gccttttacggtcccttccgcgaagcggccgagtccactccggcattcggcgaccggcgc
gcctaccagatggacccggcaaacgggcgtgaggcgttgcgcgaagtggatctcgatgtt
gccgaaggcgccgacatgatcatggtcaaaccggctggcgcctatctcgacatcatcagc
gccgtgcgccagcgctaccacctgccgctggcagcgtaccaggtgagcggcgagtatgcc
atgatcaaagcggcagcgcaactcggctggctcgacgagcgtcgcgctgcactcgaaagc
ctgatcgccattcgacgggctggcgcggatatgattatcacctacttcgccaaagacgcc
gcgcgctggattgctacagagtga

DBGET integrated database retrieval system