KEGG   Roseiflexus sp. RS-1: RoseRS_1829Help
Entry
RoseRS_1829       CDS       T00542                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_1829
   01230 Biosynthesis of amino acids
    RoseRS_1829
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_1829
   00030 Pentose phosphate pathway
    RoseRS_1829
   00051 Fructose and mannose metabolism
    RoseRS_1829
   00052 Galactose metabolism
    RoseRS_1829
  Energy metabolism
   00680 Methane metabolism
    RoseRS_1829
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RoseRS_1829
Protein phosphatases and associated proteins [BR:rrs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RoseRS_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2257901..2259019)
Genome map
AA seq 372 aa AA seqDB search
MTIPSTSRLRIAICTGGGDAPGLNAVIRAVVLSALHRGWECYGIRDGFNGILSPKEYPRG
GVIPLTRETVRGITPLGGTIIGTTNRGNPLRYPTKLPDGAVIERDRTDEIVNGLAVYGID
ALISVGGDGSMEIAAALARKGVRVIGVPKTIDNDLDGTVATFGFDTAVAFATEAIDRLHT
TAEAHQRVMVVEVMGRYAGWIALNAGVSGTANVILIPEIPYDIHKVAAKIKSREAEGRPY
SIVVVAEGARPIEGSVSLIAPREAGRAERLGGIGERVAREIEALTGKETRVVVLGHLLRG
GTPTTFDRLLALRFGAAAVRALEEGQSGVMVALDPPTVRYVPLEEATRRMKTVPLDSDTM
LTARDLGIVFGD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcccttcgacctcacgattgcgcattgccatctgcactggcggcggtgatgct
ccggggctcaacgccgttatccgcgcggttgtgctgagtgcgcttcaccgcggctgggaa
tgctatggcatccgcgatggcttcaacggcattctctcaccgaaagaatatccacggggc
ggcgtgatcccgctgacccgcgaaacggtgcgcggcattacacccctgggcggcacgatc
atcggaacaacgaatcgtgggaatcccctgcgctatcctacaaaactgcctgacggcgcc
gtgatcgagcgcgaccgcaccgacgagattgtgaatggtctcgcagtctacggtatcgat
gccctgatctcggtcggcggcgacggctcgatggagatcgcagcggcgctggcacgtaaa
ggggtgcgcgtgatcggcgtccccaaaacgatcgacaacgacctggacggaacggtggcg
accttcgggttcgatacggcggtcgcctttgcgacggaagcgatcgatcgcctgcacaca
accgccgaagcgcaccagcgagtcatggtagttgaggtcatggggcgttatgcgggatgg
attgcgctcaacgccggggtttccggaacggcgaatgttatccttattcccgaaattccc
tacgacatccataaggttgccgctaagatcaaaagccgtgaagccgaagggcgaccatac
tcgatcgtcgtcgtcgctgaaggcgcccgtccgattgaaggcagcgtctcgctgattgcc
cctagagaagccggtcgcgccgagcgtctgggaggcatcggcgaacgagtggcgcgtgag
atcgaggcgctgaccggcaaagaaacgcgcgttgtcgttctggggcacctgctgcgcggc
ggcacgccaaccacattcgaccgcctgctggcgctgcgcttcggcgccgctgccgtgcgc
gcgctcgaagaggggcagtctggcgtgatggtggcgctcgacccgccgacggtgcggtat
gtgccgctcgaagaagcgacccggcgtatgaaaaccgttccgctcgactcggataccatg
ctgacagcgcgcgatctggggattgtcttcggcgactga

DBGET integrated database retrieval system