KEGG   Roseiflexus sp. RS-1: RoseRS_1831Help
Entry
RoseRS_1831       CDS       T00542                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:rrs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rrs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rrs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rrs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rrs00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rrs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2260283..2261440)
Genome map
AA seq 385 aa AA seqDB search
MRIGILTGGGDVPGLNPCIKAVVNRANDAGIEVIGIRRGWAGLLYYNPDDPESASEWVQP
LTKADVRTIDRYGGTHLHTSRTNPQRVREKEMPEFLKGKFELTGEKKTADCTPHVLRVLE
HLGIDTLVPIGGDDTLSYAVRMHREGVRVIAIPKTMDNDVFGTDYCIGFSTAVTRSVDFL
NALRTPTGSHERIAVIELFGRNSGETALISAYLADVDRAVISEVPFDVEKLARFLVEDRR
RNPSNYSICVISEGASMIGGQVVEYGQEDAYGHRKLGGIGMITGEAIKKITGIDIVYQQL
SYLMRAGAPDSLDRMVAICYGNLAVDQLLQGHSGRMVALQNGQYTTVPVDTCVQGVKRVD
VEELYDAENYRPRVKHPLGKPMFLY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtattctgaccggcggcggtgatgttcccggcttgaatccatgcatcaag
gcggtagtaaatcgcgcaaacgacgccgggatcgaggtcatcggcattcggcgcgggtgg
gccggtttgctgtactacaacccggacgacccggagagcgcgtcggaatgggtacaaccg
ctcaccaaggcggatgtgcgcacgattgaccggtacggtggaacgcacctgcacacatca
cgcacgaacccgcagcgggtgcgcgagaaggagatgcccgaatttctcaagggcaagttc
gaactcaccggcgaaaagaaaaccgctgactgcacgccgcatgtgttgcgtgtgctggag
catctcggcatcgacacgcttgttccaatcggcggcgacgacacgctctcctacgcagtt
cgcatgcaccgcgagggagtgcgggtcatcgctatccctaaaacgatggacaacgacgtg
ttcggcactgactactgcatcgggttctcaaccgcggtcacccgcagtgttgactttctc
aacgccctgcgcacgccgaccggttcgcacgagcggattgccgtgattgaactgttcggg
cgcaattcgggggaaacggcgctgatctcggcatacctggcggacgttgatcgtgctgtc
atctccgaagtgccgttcgacgttgagaaactggcgcgcttcctggtggaagaccgccga
cgcaaccccagcaattattcgatctgcgtcatctcggaaggcgcgtcgatgatcggcggg
caggtggtcgaatatgggcaggaagacgcctatgggcaccggaaactcggcggcatcggc
atgatcaccggtgaggcgatcaagaagatcaccggcatcgacatcgtctaccagcaactg
tcatatctgatgcgcgctggcgcacccgactcgctcgaccggatggtcgccatctgttac
ggtaacctggcggtcgatcaactgctccagggacacagcgggcgcatggtggcgctccaa
aacgggcagtacaccaccgtcccggtcgatacctgcgtgcagggagtcaaacgggttgat
gtcgaagagttatacgacgcagagaactaccggccgcgggtcaaacacccgcttggcaag
ccgatgttcttgtactga

DBGET integrated database retrieval system