KEGG   Roseiflexus sp. RS-1: RoseRS_1831Help
Entry
RoseRS_1831       CDS       T00542                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00010  Glycolysis / Gluconeogenesis
rrs00030  Pentose phosphate pathway
rrs00051  Fructose and mannose metabolism
rrs00052  Galactose metabolism
rrs00680  Methane metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
rrs01120  Microbial metabolism in diverse environments
rrs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_1831
   00030 Pentose phosphate pathway
    RoseRS_1831
   00051 Fructose and mannose metabolism
    RoseRS_1831
   00052 Galactose metabolism
    RoseRS_1831
  Energy metabolism
   00680 Methane metabolism
    RoseRS_1831
Enzymes [BR:rrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RoseRS_1831
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     RoseRS_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABQ90220
UniProt: A5UUB7
Position
complement(2260283..2261440)
Genome map
AA seq 385 aa AA seqDB search
MRIGILTGGGDVPGLNPCIKAVVNRANDAGIEVIGIRRGWAGLLYYNPDDPESASEWVQP
LTKADVRTIDRYGGTHLHTSRTNPQRVREKEMPEFLKGKFELTGEKKTADCTPHVLRVLE
HLGIDTLVPIGGDDTLSYAVRMHREGVRVIAIPKTMDNDVFGTDYCIGFSTAVTRSVDFL
NALRTPTGSHERIAVIELFGRNSGETALISAYLADVDRAVISEVPFDVEKLARFLVEDRR
RNPSNYSICVISEGASMIGGQVVEYGQEDAYGHRKLGGIGMITGEAIKKITGIDIVYQQL
SYLMRAGAPDSLDRMVAICYGNLAVDQLLQGHSGRMVALQNGQYTTVPVDTCVQGVKRVD
VEELYDAENYRPRVKHPLGKPMFLY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggtattctgaccggcggcggtgatgttcccggcttgaatccatgcatcaag
gcggtagtaaatcgcgcaaacgacgccgggatcgaggtcatcggcattcggcgcgggtgg
gccggtttgctgtactacaacccggacgacccggagagcgcgtcggaatgggtacaaccg
ctcaccaaggcggatgtgcgcacgattgaccggtacggtggaacgcacctgcacacatca
cgcacgaacccgcagcgggtgcgcgagaaggagatgcccgaatttctcaagggcaagttc
gaactcaccggcgaaaagaaaaccgctgactgcacgccgcatgtgttgcgtgtgctggag
catctcggcatcgacacgcttgttccaatcggcggcgacgacacgctctcctacgcagtt
cgcatgcaccgcgagggagtgcgggtcatcgctatccctaaaacgatggacaacgacgtg
ttcggcactgactactgcatcgggttctcaaccgcggtcacccgcagtgttgactttctc
aacgccctgcgcacgccgaccggttcgcacgagcggattgccgtgattgaactgttcggg
cgcaattcgggggaaacggcgctgatctcggcatacctggcggacgttgatcgtgctgtc
atctccgaagtgccgttcgacgttgagaaactggcgcgcttcctggtggaagaccgccga
cgcaaccccagcaattattcgatctgcgtcatctcggaaggcgcgtcgatgatcggcggg
caggtggtcgaatatgggcaggaagacgcctatgggcaccggaaactcggcggcatcggc
atgatcaccggtgaggcgatcaagaagatcaccggcatcgacatcgtctaccagcaactg
tcatatctgatgcgcgctggcgcacccgactcgctcgaccggatggtcgccatctgttac
ggtaacctggcggtcgatcaactgctccagggacacagcgggcgcatggtggcgctccaa
aacgggcagtacaccaccgtcccggtcgatacctgcgtgcagggagtcaaacgggttgat
gtcgaagagttatacgacgcagagaactaccggccgcgggtcaaacacccgcttggcaag
ccgatgttcttgtactga

DBGET integrated database retrieval system