KEGG   Roseiflexus sp. RS-1: RoseRS_1902Help
Entry
RoseRS_1902       CDS       T00542                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RoseRS_1902
Enzymes [BR:rrs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RoseRS_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2360267..2361406)
Genome map
AA seq 379 aa AA seqDB search
MHMTGSSSETHNGRETDSVPTTLPVYPFTAIVGQAELKLALLLCVIDPTIGGVMVMGHRG
TAKSTAVRALAALLPPQRAVAGCPYGCDPAAPSPICPHCSAPDQHTTKNGQEKRRAGAKR
PPSILRPVPVVDLPLGATEDRVVGALDIERALVEGVQAFAPGLLARANRGFLYIDEVNLL
EDHLVDLLLDVAQSGVNVVEREGISVRHPARFVLVGSGNPEEGDLRPQLLDRFGLHARIT
TIDDVAERVEIVKRRRAFDADPVAFAQQWEREQQRLQRRIRAAQKRLSSVELTDEALYAA
ARLCVALNIDGHRGELTLARAAVALAAFEGRDSAQPSDIARVATLSLRHRLRKDPLETSG
DDTRIERAVAETIGAAARA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgacaggatcatcatctgaaacccataatggcagggagaccgacagcgtcccc
acaacgctgccggtctatccattcactgcgattgtcggtcaggcggaactgaaactcgcg
ctgctcctctgtgtgattgatccaacgataggcggcgttatggtcatggggcatcgcgga
acagcaaagagcacagcggtgcgcgcgctggctgcgctccttccgccgcagcgcgccgtc
gccgggtgcccctacggatgcgatccggcagcgccatcgccaatctgtccacactgctct
gcacccgatcagcacacaacaaagaacgggcaggagaagcggcgcgctggcgcgaaacgc
ccgccctcgatcctgcgcccggttccggtggttgatctgccgcttggtgcaactgaggat
cgggtggtcggcgcactcgacatcgagcgtgcgctggtcgaaggagtgcaggcatttgcg
ccgggattgctggcgcgcgccaatcgtggctttctgtacatcgatgaagtgaacctgctc
gaagatcacctggtcgatctgttgctcgatgtggcgcagagcggggtcaatgtcgtcgaa
cgtgaaggaatttcggtacggcacccggcgcgttttgtgctcgtcggcagcggcaacccg
gaggagggtgacctgcgcccgcaactgctcgaccggttcgggctgcatgcgcggatcacg
accatcgacgatgtggcggagcgggttgagattgtcaagcgccggcgcgcgttcgacgcc
gatccagttgcctttgcgcaacagtgggagcgggaacagcagcgcctccagcggcgcatt
cgcgcagcgcagaagcgtctcagttccgttgaactgaccgatgaggcattgtacgcggca
gcgcgtttgtgtgtcgcgctgaacatcgacggtcaccgcggcgagttgacgctggcgcgt
gcagccgtggcgctggcggcgttcgagggacgcgacagcgcccaaccgtctgacatcgcg
cgggttgcgaccctctcactgcgtcaccggttgcgcaaagatccgctcgagacctccggc
gacgatacacgcatcgagcgcgccgtcgcggagacgatcggtgcggcagcgcgggcgtaa

DBGET integrated database retrieval system