KEGG   Roseiflexus sp. RS-1: RoseRS_1902Help
Entry
RoseRS_1902       CDS       T00542                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs00860  Porphyrin and chlorophyll metabolism
rrs01100  Metabolic pathways
rrs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RoseRS_1902
Enzymes [BR:rrs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RoseRS_1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM Sigma54_activat AAA_22 AAA_29 DUF815
Motif
Other DBs
NCBI-ProteinID: ABQ90291
UniProt: A5UUI8
Position
complement(2360267..2361406)
Genome map
AA seq 379 aa AA seqDB search
MHMTGSSSETHNGRETDSVPTTLPVYPFTAIVGQAELKLALLLCVIDPTIGGVMVMGHRG
TAKSTAVRALAALLPPQRAVAGCPYGCDPAAPSPICPHCSAPDQHTTKNGQEKRRAGAKR
PPSILRPVPVVDLPLGATEDRVVGALDIERALVEGVQAFAPGLLARANRGFLYIDEVNLL
EDHLVDLLLDVAQSGVNVVEREGISVRHPARFVLVGSGNPEEGDLRPQLLDRFGLHARIT
TIDDVAERVEIVKRRRAFDADPVAFAQQWEREQQRLQRRIRAAQKRLSSVELTDEALYAA
ARLCVALNIDGHRGELTLARAAVALAAFEGRDSAQPSDIARVATLSLRHRLRKDPLETSG
DDTRIERAVAETIGAAARA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgacaggatcatcatctgaaacccataatggcagggagaccgacagcgtcccc
acaacgctgccggtctatccattcactgcgattgtcggtcaggcggaactgaaactcgcg
ctgctcctctgtgtgattgatccaacgataggcggcgttatggtcatggggcatcgcgga
acagcaaagagcacagcggtgcgcgcgctggctgcgctccttccgccgcagcgcgccgtc
gccgggtgcccctacggatgcgatccggcagcgccatcgccaatctgtccacactgctct
gcacccgatcagcacacaacaaagaacgggcaggagaagcggcgcgctggcgcgaaacgc
ccgccctcgatcctgcgcccggttccggtggttgatctgccgcttggtgcaactgaggat
cgggtggtcggcgcactcgacatcgagcgtgcgctggtcgaaggagtgcaggcatttgcg
ccgggattgctggcgcgcgccaatcgtggctttctgtacatcgatgaagtgaacctgctc
gaagatcacctggtcgatctgttgctcgatgtggcgcagagcggggtcaatgtcgtcgaa
cgtgaaggaatttcggtacggcacccggcgcgttttgtgctcgtcggcagcggcaacccg
gaggagggtgacctgcgcccgcaactgctcgaccggttcgggctgcatgcgcggatcacg
accatcgacgatgtggcggagcgggttgagattgtcaagcgccggcgcgcgttcgacgcc
gatccagttgcctttgcgcaacagtgggagcgggaacagcagcgcctccagcggcgcatt
cgcgcagcgcagaagcgtctcagttccgttgaactgaccgatgaggcattgtacgcggca
gcgcgtttgtgtgtcgcgctgaacatcgacggtcaccgcggcgagttgacgctggcgcgt
gcagccgtggcgctggcggcgttcgagggacgcgacagcgcccaaccgtctgacatcgcg
cgggttgcgaccctctcactgcgtcaccggttgcgcaaagatccgctcgagacctccggc
gacgatacacgcatcgagcgcgccgtcgcggagacgatcggtgcggcagcgcgggcgtaa

DBGET integrated database retrieval system