KEGG   Roseiflexus sp. RS-1: RoseRS_1990Help
Entry
RoseRS_1990       CDS       T00542                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RoseRS_1990
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RoseRS_1990
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RoseRS_1990
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RoseRS_1990
Exosome [BR:rrs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RoseRS_1990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2470151..2471725
Genome map
AA seq 524 aa AA seqDB search
MFGGKRTLGLIGTVILLIATVSATAAGTGIPELQGSRRTGNVIFIHPDGAGLNHWSAARI
YWYGPDALSPWDTLPEMAAYRGHMEDILTGTSNGGATTHAFGYKVEGLGSFGKDGDGDAA
RSIRALSGYPGSIMREAINNGHPVALVNDGDIAEPGTAAFVSEVGNRNLDNEIVRQILDG
RPGFEGEQPPHIILAGGESFFLPVGTPQCAPDAITLDCHVHLDPITGAGPSRTDGRNLLK
EFEAKGYVIVRTRAEFEALRERVNSDRRYAPYVLGLFAADDIFNDVPEERLISAGLVDPS
IDVNDKRTNLILFGSRPGTLGYNPPTAAEMTDLALTIIQRCSRQAGKPFMMVVETESVDN
FGNNDNAIGTLTGLKHANDVIEVVQRFQQRNRNTLILTAADSDAGGLQVGAWDPARNVAD
YNNNPTGVSAQNVRSPLDGRYGRNSPPFLSEPDAYGRRMAFAVSWVGTPDVSGGILSRAQ
GLNAAELRRTFRGRFDNTDVYRLMYLSLFGTALPSSVGQEAPDR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaggaaaacgcacgctcggtctgattggtacagttatcctgctgatcgcaacg
gtctctgcgacagcggcaggtacgggcatcccggaattgcagggttcgcggcgcaccggc
aacgtcatcttcatccatcccgacggcgctggcttgaaccactggagcgccgcgcgcatc
tactggtacggtcctgatgcgctgagcccctgggacacactgcctgagatggcggcctat
cgggggcacatggaggacattctgacgggaacgtcgaatggcggcgcgaccacccacgcc
tttggctacaaagtcgaaggtcttggatcgtttggcaaggatggcgacggtgatgccgct
cgcagcattcgagcgctctccggctatcccggcagtatcatgcgcgaagcgatcaataac
ggtcacccggtggcgctggtaaacgatggcgatattgccgagcctggcacagccgctttc
gtctctgaggtcggcaaccgcaacctcgacaacgaaattgtccgccagatcctcgacggt
cgtccaggtttcgagggcgagcagccgccacacatcattcttgctggcggcgagagtttc
ttcctgccggtcggcacgccgcagtgtgcgccggatgccataacgctcgactgtcatgtc
cacctcgatccgatcaccggcgccggtcccagccgcacggatggtcgcaacctgctcaaa
gagttcgaggcgaaggggtatgtgatcgtgcgcacccgcgccgagttcgaggcgctgcgt
gagcgcgtgaatagcgaccgccggtatgcgccgtatgtgctcggtctgttcgctgccgat
gatattttcaacgacgtgccagaggaacgcctgatcagcgcgggtctggtcgatccttcc
atcgatgtcaacgacaagcgcaccaacctgatcctctttggcagccgccccggcacgctc
ggttataacccgccaaccgccgctgagatgaccgatcttgcgctgacgatcattcagcgc
tgctcacggcaggcaggaaagccgttcatgatggttgtcgaaacggaaagcgtggacaac
ttcggtaacaacgacaacgcgatcggtacgcttaccggtctgaagcatgcgaatgatgtg
atcgaggttgtgcagcgcttccagcagcgcaatcgcaacacgctgatccttaccgcagcg
gatagcgatgcgggtggcttgcaggttggcgcgtgggatccggccaggaatgtggcggac
tacaataacaacccgactggtgtcagtgcgcaaaatgtgcgttcaccgctcgatgggcgc
tacgggcgcaactcgccgccgttcctgagcgagcctgatgcgtatggcaggcgaatggca
ttcgcggtaagctgggtgggcacgcccgacgtatcgggtggtatcctctcgcgtgctcag
ggtctgaacgctgcggaactgcggcgcacgttccgcgggcgcttcgacaacactgatgtc
taccgtctgatgtacctgtccctcttcggcacggcgctgccgtcgtcggtcggtcaggag
gcgcctgaccggtag

DBGET integrated database retrieval system