KEGG   Roseiflexus sp. RS-1: RoseRS_2004Help
Entry
RoseRS_2004       CDS       T00542                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_2004
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2004
   00620 Pyruvate metabolism
    RoseRS_2004
   00640 Propanoate metabolism
    RoseRS_2004
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RoseRS_2004
   00680 Methane metabolism
    RoseRS_2004
Enzymes [BR:rrs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RoseRS_2004
Lipid biosynthesis proteins [BR:rrs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RoseRS_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2483934..2485853)
Genome map
AA seq 639 aa AA seqDB search
MTLTHAIGSTNSVETADVVVNPPEEAARIANLTDYEAVYRRSIEDPQGFWAEAAQALHWF
EPFHTVLDDSKAPFYKWFVGGKTNMAYNALDRHVQTWRKNKVALIWESEDGEVRTYTYWQ
LYRDVNKFANVLKSLGVRKGDRVAIYTGRCPEQAIAMLACARIGAVHTVVYGGLSTEALR
SRIDDAHAKVLVVADGSLLNGKIVKLKEIADQAVEHAPSIETCVVIRRTGHPVDIRSGRD
YWWHELMALPIASARCESEVLDAEDPFFIIYTSGSTGKPKGVVHTLGGYMVDVYTTLKYV
LDFKEEDTLFCTSDAGWIVGHSIVLYGPLMHGITTLMYEGAPAYPYPDRWWHLIERHGVT
LMFTAPTGVRGLMRYGDAWPKRRDLSTLRLLACAGEPLNPEAWRWFYEVIGQRRCPVIDN
WWQTETSRPMLSNFACLPMKPGSCGFPAPGVAIDVVDEQGQSVPPGVEGSLVITRPWPAM
LRTIYGDDQRYIEQYWSRYPGMYLTGDAAKRDADGYIWIIGRTDDVIKVSGYRLGTAEVE
SALVSHPAVAEAAVIGLPHPVRGNAIHAFVLLRAGHSPSEELANELKAHVGKVMGPIAKP
ETISFPPTLPKTRSGKIMRRVLRAQALGEPLGDLSTMEG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgacactcacccacgcgattggttcgaccaacagcgtcgaaaccgccgacgttgttgtg
aatccgccggaagaggcagcacgcattgcgaacctgaccgactatgaagcggtctatcgc
cgttcgatcgaggatccgcaggggttttgggcagaagcagcgcaggcgctgcactggttc
gagccgttccacaccgtgctcgacgacagcaaggcgcccttctacaagtggttcgtcggc
ggcaagacgaatatggcgtacaacgcgctggatcggcatgtgcagacctggcgcaaaaac
aaggtggcattgatctgggaaagtgaagacggcgaagttcgtacctacacctactggcaa
ctctaccgcgacgtcaataagttcgccaatgtgctcaagtcgctcggcgtgcgcaaagga
gaccgggtcgccatctacaccggtcgctgcccggaacaggcgattgcgatgctggcgtgc
gcccgaatcggcgcggttcacacggtcgtttacggcggtctttcaaccgaagcgttgcgc
agtcggatcgacgatgcccacgcgaaggtgttggtcgtggcggatggcagtttgctgaac
ggcaagatcgtcaaattgaaagagatcgccgatcaggcggtcgaacatgctccttccatc
gaaacctgtgttgttatcagacgcaccggtcatccggtcgatattcgcagcgggcgcgat
tactggtggcacgaactcatggcgctgccaatcgcaagcgcgcgctgtgagagcgaagtc
ctcgatgccgaagacccgttcttcatcatttacacctccggttccaccggcaaacccaaa
ggggtggtgcatacgcttggcgggtacatggtcgatgtctacaccacactgaagtatgtg
ctcgacttcaaggaagaagatacgctcttctgcacatccgacgctggctggatcgtcggg
cactcgattgtgctgtacggtccgttgatgcacggcatcacgacgctgatgtacgaaggc
gctcccgcctacccctacccggatcgctggtggcacctgatcgaacgccacggggttaca
ttaatgttcacggcgccgaccggggtgcgcggattgatgcggtacggcgatgcctggccc
aaacgccgcgatctgagcacgctgcgtctgctggcgtgcgccggtgaaccgctcaaccct
gaagcctggcgctggttctatgaagtgatcggtcagcgacgatgcccggtgatcgataac
tggtggcagactgaaacgtcgcgcccgatgctctccaactttgcctgtctgccgatgaaa
cctggctcgtgcggtttcccggcgccgggtgttgcaattgatgttgttgatgagcagggg
cagagcgtgccgccgggggtcgagggatcactggtcattacccgcccgtggcccgcgatg
ctgcgcaccatctatggcgacgaccagcgctatatcgagcagtactggagccgctatccg
ggcatgtatctcaccggcgacgcggcaaaacgcgatgccgacgggtatatctggatcatc
gggcgcaccgacgatgtgatcaaagtctccgggtatcgcctgggcaccgccgaagtcgaa
agcgcgctcgtgtcgcatccggcggtggcggaggccgctgtgattggcttgccgcatccg
gtgcgcggcaatgcgatccacgccttcgtcctgctccgcgccggtcattcgccgtcggaa
gaactcgccaacgaactgaaagcgcacgttggcaaggtgatgggaccgattgccaagccg
gaaacgatctccttcccgcccacactgcccaagacgcgctcaggaaagatcatgcgtcgt
gtgctgcgcgcccaggcgctcggtgagccgcttggcgacctcagcactatggaaggctaa

DBGET integrated database retrieval system