KEGG   Roseiflexus sp. RS-1: RoseRS_2004Help
Entry
RoseRS_2004       CDS       T00542                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_2004
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2004
   00620 Pyruvate metabolism
    RoseRS_2004
   00640 Propanoate metabolism
    RoseRS_2004
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    RoseRS_2004
   00680 Methane metabolism
    RoseRS_2004
Enzymes [BR:rrs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RoseRS_2004
Lipid biosynthesis proteins [BR:rrs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RoseRS_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2483934..2485853)
Genome map
AA seq 639 aa AA seqDB search
MTLTHAIGSTNSVETADVVVNPPEEAARIANLTDYEAVYRRSIEDPQGFWAEAAQALHWF
EPFHTVLDDSKAPFYKWFVGGKTNMAYNALDRHVQTWRKNKVALIWESEDGEVRTYTYWQ
LYRDVNKFANVLKSLGVRKGDRVAIYTGRCPEQAIAMLACARIGAVHTVVYGGLSTEALR
SRIDDAHAKVLVVADGSLLNGKIVKLKEIADQAVEHAPSIETCVVIRRTGHPVDIRSGRD
YWWHELMALPIASARCESEVLDAEDPFFIIYTSGSTGKPKGVVHTLGGYMVDVYTTLKYV
LDFKEEDTLFCTSDAGWIVGHSIVLYGPLMHGITTLMYEGAPAYPYPDRWWHLIERHGVT
LMFTAPTGVRGLMRYGDAWPKRRDLSTLRLLACAGEPLNPEAWRWFYEVIGQRRCPVIDN
WWQTETSRPMLSNFACLPMKPGSCGFPAPGVAIDVVDEQGQSVPPGVEGSLVITRPWPAM
LRTIYGDDQRYIEQYWSRYPGMYLTGDAAKRDADGYIWIIGRTDDVIKVSGYRLGTAEVE
SALVSHPAVAEAAVIGLPHPVRGNAIHAFVLLRAGHSPSEELANELKAHVGKVMGPIAKP
ETISFPPTLPKTRSGKIMRRVLRAQALGEPLGDLSTMEG
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgacactcacccacgcgattggttcgaccaacagcgtcgaaaccgccgacgttgttgtg
aatccgccggaagaggcagcacgcattgcgaacctgaccgactatgaagcggtctatcgc
cgttcgatcgaggatccgcaggggttttgggcagaagcagcgcaggcgctgcactggttc
gagccgttccacaccgtgctcgacgacagcaaggcgcccttctacaagtggttcgtcggc
ggcaagacgaatatggcgtacaacgcgctggatcggcatgtgcagacctggcgcaaaaac
aaggtggcattgatctgggaaagtgaagacggcgaagttcgtacctacacctactggcaa
ctctaccgcgacgtcaataagttcgccaatgtgctcaagtcgctcggcgtgcgcaaagga
gaccgggtcgccatctacaccggtcgctgcccggaacaggcgattgcgatgctggcgtgc
gcccgaatcggcgcggttcacacggtcgtttacggcggtctttcaaccgaagcgttgcgc
agtcggatcgacgatgcccacgcgaaggtgttggtcgtggcggatggcagtttgctgaac
ggcaagatcgtcaaattgaaagagatcgccgatcaggcggtcgaacatgctccttccatc
gaaacctgtgttgttatcagacgcaccggtcatccggtcgatattcgcagcgggcgcgat
tactggtggcacgaactcatggcgctgccaatcgcaagcgcgcgctgtgagagcgaagtc
ctcgatgccgaagacccgttcttcatcatttacacctccggttccaccggcaaacccaaa
ggggtggtgcatacgcttggcgggtacatggtcgatgtctacaccacactgaagtatgtg
ctcgacttcaaggaagaagatacgctcttctgcacatccgacgctggctggatcgtcggg
cactcgattgtgctgtacggtccgttgatgcacggcatcacgacgctgatgtacgaaggc
gctcccgcctacccctacccggatcgctggtggcacctgatcgaacgccacggggttaca
ttaatgttcacggcgccgaccggggtgcgcggattgatgcggtacggcgatgcctggccc
aaacgccgcgatctgagcacgctgcgtctgctggcgtgcgccggtgaaccgctcaaccct
gaagcctggcgctggttctatgaagtgatcggtcagcgacgatgcccggtgatcgataac
tggtggcagactgaaacgtcgcgcccgatgctctccaactttgcctgtctgccgatgaaa
cctggctcgtgcggtttcccggcgccgggtgttgcaattgatgttgttgatgagcagggg
cagagcgtgccgccgggggtcgagggatcactggtcattacccgcccgtggcccgcgatg
ctgcgcaccatctatggcgacgaccagcgctatatcgagcagtactggagccgctatccg
ggcatgtatctcaccggcgacgcggcaaaacgcgatgccgacgggtatatctggatcatc
gggcgcaccgacgatgtgatcaaagtctccgggtatcgcctgggcaccgccgaagtcgaa
agcgcgctcgtgtcgcatccggcggtggcggaggccgctgtgattggcttgccgcatccg
gtgcgcggcaatgcgatccacgccttcgtcctgctccgcgccggtcattcgccgtcggaa
gaactcgccaacgaactgaaagcgcacgttggcaaggtgatgggaccgattgccaagccg
gaaacgatctccttcccgcccacactgcccaagacgcgctcaggaaagatcatgcgtcgt
gtgctgcgcgcccaggcgctcggtgagccgcttggcgacctcagcactatggaaggctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system