KEGG   Roseiflexus sp. RS-1: RoseRS_2044Help
Entry
RoseRS_2044       CDS       T00542                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rrs00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2533053..2534729
Genome map
AA seq 558 aa AA seqDB search
MIETTITESVSGRLASWIEPDGRRSETYRLDGLVAAGSVRLFNRASLIDALRRDGVSLPD
DCADGMILLRLYTQYGSRGFALANGMFALAILDGEDLILVRDHAGARTLFYTRFEERWVA
SASLGALRSLIGQHARLNLNAVRSFLTFAYLPGDETLIDGVYEMRPGRCLRLCADGARRE
DVFWEPREYEWCEADPPEVYAQRLRNLLEQAVAARLPVNQDVGVFLSGGIDSSLVTALAA
RLHDRPVRTYAINFGDEYPNELAYSGLVAAHCRTTHTVLTFDGKTVADHLAETVALLDCP
VGDPLTTPNLLLARAAARDGLAVILNGEGGDPVFGGPKNLPMLMFEFHRDDPDPAARARA
YLRSYQKCYGELDRLLTPDVLEALRDAPSLERHVQPYLESPRMTSFLNRLLYTNLRTKGA
HHILPKVERLTAASGVEGRSPLFDPHLIDAAFATPPALKLHGLQEKWILKLAVRDLLPET
ILNRPKSGMLMPVQYWLHGPLREMANDLLLGSQAQARGLFREQTVRVWMQGRGLIWRRHG
QFIWLLLTLELWLRAYRL
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgattgagacgacaatcacagaatcggttagcggtcgtcttgcctcctggatcgagccc
gacggacgtcggtcggaaacgtaccggctcgatggtctggttgcggctggctcggtgcgg
ttgttcaaccgtgcctctctgatcgatgcgctgcggcgcgatggcgtctcattgccggac
gattgcgccgatgggatgatcctgttgcgcctgtacacacagtatggttcgcgtggcttt
gcgcttgccaatggtatgtttgcgctcgccatcctcgacggcgaagacctgatcctggtg
cgcgatcacgctggagcgcgcacgctgttctatacccgcttcgaggaacgatgggtcgct
tctgcgtcactgggcgcgttgcgttccctgatcggtcagcatgcgcgcctgaacctgaat
gccgtccgttcgttcctgacgtttgcctatctgccgggtgacgaaacgctgatcgatggc
gtgtacgagatgcgtccagggcgttgtctccgcctgtgcgccgatggtgcgcgccgtgag
gacgtcttctgggagccgcgcgaatatgaatggtgcgaagctgacccgccagaagtatat
gcacagcggttgcgcaatctgctcgaacaggcggttgctgcacgcctgccggtcaaccag
gacgtgggggtcttcctctctggcggcatcgacagcagcctggtcactgcgctggcagca
cggttgcacgaccgaccggtacgcacgtatgcgatcaattttggcgatgaataccccaac
gaactggcgtactccggtctggtcgctgcacactgccgtacaacgcatactgtgctcaca
ttcgatggaaagactgtcgccgaccatctggcggaaaccgttgccctgctcgactgtccg
gtcggcgacccgctcaccacgcccaacctgctcctggcgcgcgccgcagcgcgtgatggt
ctggcggtgatcctgaacggcgaaggcggcgatccggtgtttggcggtcccaagaacctg
ccgatgctgatgttcgagttccaccgcgatgatccagacccggcggcgcgggcacgcgcc
tatttgcgctcgtatcagaagtgctacggcgaactggatcggttgctcacccccgatgtg
ctggaagcgttgcgtgatgcgccatcgctggagcgccacgtgcaaccgtacctcgagtcg
ccgcgcatgacctcgttcctgaaccgtctgctgtacaccaacctgcgcacgaaaggcgcg
caccacattctgccgaaagtcgagcgcctgaccgcagccagtggtgtcgaagggcgttcg
ccgctgtttgacccgcacctgatcgatgctgcatttgcgacaccgcctgctttgaaactc
cacggtttgcaggaaaaatggatcctgaagctcgcagtgcgcgatcttcttccggagacc
attctgaaccgtcccaagagcggtatgttgatgccggtgcagtactggctgcacggtccg
ttgcgcgagatggcgaacgacctgttgctgggatcacaggcgcaggcgcggggtctcttt
cgtgaacagacggtgcgtgtctggatgcagggcaggggtctgatctggcggcgtcacggt
caattcatctggttgctgctcacgctggaactgtggttgcgcgcatatcgattgtag

DBGET integrated database retrieval system