KEGG   Roseiflexus sp. RS-1: RoseRS_2049Help
Entry
RoseRS_2049       CDS       T00542                                 

Definition
(RefSeq) hypothetical protein
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_2049
   01230 Biosynthesis of amino acids
    RoseRS_2049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2049
   00030 Pentose phosphate pathway
    RoseRS_2049
   00051 Fructose and mannose metabolism
    RoseRS_2049
  Energy metabolism
   00680 Methane metabolism
    RoseRS_2049
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     RoseRS_2049
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     RoseRS_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2539512..2540669
Genome map
AA seq 385 aa AA seqDB search
MAAELTISCIKADVGGFVGHSAIHPALQDEAGRQLEIARRRGMLIDFHVTACGDDLGLLM
THRLGIDNHEVHRLAWDVFDICTRVAKELKLYGAGQDLLKDAFSGNVRGMGPGIAEMTIV
ERPSEPIIVFFADKTSAGAWNLPLFRMFADPFNTAGLVISPAMHDGFRFRVLDVRKGTTI
TLSTPEEMYDLLVFIGAPGRYVVERVTAKSTGAIGAVSSTQRLALIAGRYVGKDDPVCIV
RAQGEFPAVGEVLEPFTMPHIVEGWMRGSHYGPLMPCRVGDAHPGRFDGPPRVIALGFQI
AEGQLIGPRDMFDDPSFDEARHLCNVIADHLRRHGPFEPHRLPMEEMEYTTLPEVMKKLA
DRWQPVNGHAVSGEVVETLPASVAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaactgacgatcagttgcatcaaggctgatgtcggcggatttgtcgggcat
tcggcgatccatccggcgttgcaggacgaagccgggcggcaactggagatcgcgcgtcgt
cgcggtatgttgatcgatttccacgtcactgcgtgcggtgatgacctggggttgctgatg
acccatcgtctggggatcgacaaccatgaggtccatcggcttgcctgggatgtattcgat
atctgcacccgtgtggcgaaggaactgaaactgtacggcgccggacaggacctgctgaag
gatgcattttccggcaacgtgcgcgggatgggtccggggatcgccgaaatgacgattgtc
gagcgtccatcggagccgatcattgtcttcttcgccgacaaaaccagcgcaggggcgtgg
aacctgccgcttttccgcatgttcgccgatccgttcaacacggcgggtctggtgatttca
ccggcgatgcacgacgggtttcgcttccgcgtgctggatgtcaggaagggcacgacgatc
accctcagcacgccggaagagatgtacgacctgctggtcttcattggcgcaccggggcgc
tacgtcgtcgaacgtgtgacggcgaagagcaccggcgcgattggtgcggtttcgtcaacg
caacgactggcgctgattgccgggcgctatgtcgggaaggacgacccggtgtgcatcgtg
cgggcgcagggcgagttcccggcggtcggcgaggtgctggagccattcaccatgccgcac
atcgtcgaggggtggatgcgcggatcgcactacggtccgctgatgccgtgtcgtgtggga
gacgcccatccggggcgctttgacggaccgccgcgggtcattgcgttagggttccagatc
gccgagggacagttgatcggaccgcgggatatgttcgatgatcccagttttgatgaggcg
cgtcatttgtgcaacgtcatcgccgatcatctgcgccgtcatggaccgttcgagccgcat
cgtctgccgatggaagaaatggagtacaccacgcttccagaggtgatgaaaaaactggca
gaccgctggcaaccggtgaatggtcatgcggtgagcggcgaagtggtggagacgttgccc
gccagcgttgcatcgtga

DBGET integrated database retrieval system