KEGG   Roseiflexus sp. RS-1: RoseRS_2049Help
Entry
RoseRS_2049       CDS       T00542                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RoseRS_2049
   01230 Biosynthesis of amino acids
    RoseRS_2049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RoseRS_2049
   00030 Pentose phosphate pathway
    RoseRS_2049
   00051 Fructose and mannose metabolism
    RoseRS_2049
  Energy metabolism
   00680 Methane metabolism
    RoseRS_2049
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     RoseRS_2049
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     RoseRS_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2539512..2540669
Genome map
AA seq 385 aa AA seqDB search
MAAELTISCIKADVGGFVGHSAIHPALQDEAGRQLEIARRRGMLIDFHVTACGDDLGLLM
THRLGIDNHEVHRLAWDVFDICTRVAKELKLYGAGQDLLKDAFSGNVRGMGPGIAEMTIV
ERPSEPIIVFFADKTSAGAWNLPLFRMFADPFNTAGLVISPAMHDGFRFRVLDVRKGTTI
TLSTPEEMYDLLVFIGAPGRYVVERVTAKSTGAIGAVSSTQRLALIAGRYVGKDDPVCIV
RAQGEFPAVGEVLEPFTMPHIVEGWMRGSHYGPLMPCRVGDAHPGRFDGPPRVIALGFQI
AEGQLIGPRDMFDDPSFDEARHLCNVIADHLRRHGPFEPHRLPMEEMEYTTLPEVMKKLA
DRWQPVNGHAVSGEVVETLPASVAS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggaactgacgatcagttgcatcaaggctgatgtcggcggatttgtcgggcat
tcggcgatccatccggcgttgcaggacgaagccgggcggcaactggagatcgcgcgtcgt
cgcggtatgttgatcgatttccacgtcactgcgtgcggtgatgacctggggttgctgatg
acccatcgtctggggatcgacaaccatgaggtccatcggcttgcctgggatgtattcgat
atctgcacccgtgtggcgaaggaactgaaactgtacggcgccggacaggacctgctgaag
gatgcattttccggcaacgtgcgcgggatgggtccggggatcgccgaaatgacgattgtc
gagcgtccatcggagccgatcattgtcttcttcgccgacaaaaccagcgcaggggcgtgg
aacctgccgcttttccgcatgttcgccgatccgttcaacacggcgggtctggtgatttca
ccggcgatgcacgacgggtttcgcttccgcgtgctggatgtcaggaagggcacgacgatc
accctcagcacgccggaagagatgtacgacctgctggtcttcattggcgcaccggggcgc
tacgtcgtcgaacgtgtgacggcgaagagcaccggcgcgattggtgcggtttcgtcaacg
caacgactggcgctgattgccgggcgctatgtcgggaaggacgacccggtgtgcatcgtg
cgggcgcagggcgagttcccggcggtcggcgaggtgctggagccattcaccatgccgcac
atcgtcgaggggtggatgcgcggatcgcactacggtccgctgatgccgtgtcgtgtggga
gacgcccatccggggcgctttgacggaccgccgcgggtcattgcgttagggttccagatc
gccgagggacagttgatcggaccgcgggatatgttcgatgatcccagttttgatgaggcg
cgtcatttgtgcaacgtcatcgccgatcatctgcgccgtcatggaccgttcgagccgcat
cgtctgccgatggaagaaatggagtacaccacgcttccagaggtgatgaaaaaactggca
gaccgctggcaaccggtgaatggtcatgcggtgagcggcgaagtggtggagacgttgccc
gccagcgttgcatcgtga

DBGET integrated database retrieval system