KEGG   Roseiflexus sp. RS-1: RoseRS_2355Help
Entry
RoseRS_2355       CDS       T00542                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
rrs  Roseiflexus sp. RS-1
Brite
Enzymes [BR:rrs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     RoseRS_2355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2914605..2915456
Genome map
AA seq 283 aa AA seqDB search
MNHPLQSSPASAPFDARSRSFAVFAGTTGVLLIHGFGGDPTEVLPLAAALIHDGYSVYAP
LLPGHGTLPDALAGVQWQQWAEATAHGFAALRRRCDDVVVVGFSMGGLLALILAAHLPVA
RLAVLAPALRLRGQLLVNLSSIARHVISWYYPLAGADFSDPELRALLRNRVPDANLDDPL
VCEQLRRMVRVPLEAVHQLTLVQRSARRLLPRVTAPTLIVQGRNDQTVDPRSAEQILRHI
GSLDRQLIWMEGYGHQLLVGDGGERTVRTIMAWIQNDNAGRGM
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcctttgcaatcttctcctgcgtcggcgccgttcgatgcccgcagccgttcg
tttgccgtctttgccggcacgaccggcgtcttgttgatccacggttttggcggtgatccc
accgaagtgttgccactggctgccgccctgatccacgatggttacagcgtttatgctccg
ctgcttcctggtcatggaacgctccccgatgccctggctggcgttcaatggcagcagtgg
gcagaagcgactgcacacgggttcgcagcattgcgtcggcgttgtgacgatgttgtggtt
gtgggattctcgatgggcggtctgctcgcgctgatcctggcggcgcatctgccggttgca
cgcctggcagtcctggcgccagcgctccggttgcgtggtcaactgctggtcaatctgagc
agtatcgccagacacgtcatttcgtggtactatcctcttgctggcgctgatttcagcgat
ccggagttgcgtgctctgctgcgcaaccgcgtaccggatgcaaatcttgatgatccgctc
gtttgtgaacagttgcgtcgtatggtgcgggtacccctggaggcagtacatcaactgacc
cttgtgcaacgctcggcacgacggcttctgcctcgcgtcaccgcaccgacgctgattgtc
caggggcggaacgatcagaccgtcgatccacgttcggctgaacagattctgcgacatatc
ggatctcttgaccgtcaactgatctggatggaagggtatggacatcagttgctggtcggc
gatggcggtgaacgcacggttcgtactatcatggcatggattcaaaatgataatgccggg
agggggatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system